BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0035 (682 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 28 6.0 03_02_0870 + 11964135-11964224,11965013-11965175,11965262-119653... 28 7.9 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 331 LPKLAHLAPSSDLRLHRSSKPEFSPI 408 L L +LAP DLR+ SSKP F I Sbjct: 259 LETLVNLAPVLDLRIFSSSKPSFIKI 284 >03_02_0870 + 11964135-11964224,11965013-11965175,11965262-11965380, 11965971-11966083,11966179-11966234,11966320-11966417, 11966588-11966725,11966820-11967125,11967208-11967471, 11967587-11967754,11967838-11968056,11968115-11968158, 11968761-11968830,11968949-11969110,11969672-11969779, 11969873-11969910,11970121-11970265,11970800-11970926, 11971037-11971230,11971529-11971659,11972014-11972089, 11972218-11972328,11972465-11972647,11973264-11973407, 11973946-11973969,11974555-11974728,11974808-11975155, 11975232-11975561,11975776-11975961,11976052-11977026, 11977145-11977399 Length = 1852 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/60 (28%), Positives = 31/60 (51%) Frame = -1 Query: 415 NFKWVRTPAYSNDEAGDLMTVPSGPILVSRNGAXG*TKRSVKAPKKRSWDTMKGLVAHXS 236 +F W P + N++AG + PS P+ S +G+ ++ S+ P + T+ G + H S Sbjct: 282 SFAWAMIPLFENNQAGGAAS-PSSPLAPSMSGSS--SQDSIVEPISKL--TLDGKLNHYS 336 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,452,727 Number of Sequences: 37544 Number of extensions: 452277 Number of successful extensions: 916 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 896 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -