BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0035 (682 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 69 3e-12 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 48 5e-06 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) 43 3e-04 SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 39 0.004 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.013 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.86 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 31 1.1 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 69.3 bits (162), Expect = 3e-12 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -2 Query: 240 TAGRWPWKSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 TAGRWPWK ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 69.3 bits (162), Expect = 3e-12 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -2 Query: 240 TAGRWPWKSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 TAGRWPWK ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 69.3 bits (162), Expect = 3e-12 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -2 Query: 240 TAGRWPWKSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 TAGRWPWK ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 54.0 bits (124), Expect = 1e-07 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = -2 Query: 240 TAGRWPWKSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 TAGR + ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 50.8 bits (116), Expect = 1e-06 Identities = 32/67 (47%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Frame = -2 Query: 312 DEPNVVLRRLKNAHGTP*KGWSLXT---AGRWPWKSESAKECATTHHPKQPALKMDGAEA 142 DEPN LR P KG G W AKEC TTH PKQ ALKMDGA+A Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNP--AKECVTTHLPKQLALKMDGAQA 60 Query: 141 FCLYTTV 121 LY V Sbjct: 61 SHLYRAV 67 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -2 Query: 219 KSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 K ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -2 Query: 219 KSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 K ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -2 Query: 219 KSESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 K ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 48.8 bits (111), Expect = 4e-06 Identities = 27/54 (50%), Positives = 31/54 (57%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGFIVRVSRSSHPFKV 415 PF G LN FGSS A SAYQ WPT + H +SGF SR+S+ FKV Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.4 bits (110), Expect = 5e-06 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 213 ESAKECATTHHPKQPALKMDGAEAFCLYTTV 121 ESAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 210 SAKECATTHHPKQPALKMDGAEAFCLYTTV 121 SAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 210 SAKECATTHHPKQPALKMDGAEAFCLYTTV 121 SAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 210 SAKECATTHHPKQPALKMDGAEAFCLYTTV 121 SAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -2 Query: 210 SAKECATTHHPKQPALKMDGAEAFCLYTTV 121 SAKEC TTH PKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_20448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/51 (45%), Positives = 25/51 (49%) Frame = +2 Query: 224 GHRPAVMSDQPFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 GH PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 33 GHHKKCEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 83 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.8 bits (101), Expect = 7e-05 Identities = 30/67 (44%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Frame = -2 Query: 312 DEPNVVLRRLKNAHGTP*KGWSLXT---AGRWPWKSESAKECATTHHPKQPALKMDGAEA 142 DEPN LR P KG G W KEC TT PKQ ALKMDGA+A Sbjct: 3 DEPNARLRCQSRRSSDPTKGVGCSRQQDGGHGSWNP--LKECVTTPLPKQLALKMDGAQA 60 Query: 141 FCLYTTV 121 LY V Sbjct: 61 SHLYRAV 67 >SB_40315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 44.4 bits (100), Expect = 9e-05 Identities = 27/64 (42%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +2 Query: 200 SLADSDFHG----HR-PAVMSDQPFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQ 364 S++ +F G HR P PF G LN FGSS A SAYQ WPT + H Sbjct: 19 SMSSPNFQGPSRAHRTPQEEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHS 78 Query: 365 ISGF 376 +SGF Sbjct: 79 LSGF 82 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/62 (38%), Positives = 29/62 (46%) Frame = +2 Query: 191 VAHSLADSDFHGHRPAVMSDQPFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQIS 370 + +L F G + PF G LN FGSS A SAYQ WPT + H +S Sbjct: 24 IGATLERHPFSGLVASAEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLS 83 Query: 371 GF 376 GF Sbjct: 84 GF 85 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 132 IGKTLQRHPFSGLVAS 179 IG TL+RHPFSGLVAS Sbjct: 24 IGATLERHPFSGLVAS 39 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/62 (38%), Positives = 29/62 (46%) Frame = +2 Query: 191 VAHSLADSDFHGHRPAVMSDQPFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQIS 370 + +L F G + PF G LN FGSS A SAYQ WPT + H +S Sbjct: 22 IGATLERHPFSGLVASAEQPTPFVGSDERRLWHLNRAFGSSRIASSAYQKWPTSNSHSLS 81 Query: 371 GF 376 GF Sbjct: 82 GF 83 Score = 33.1 bits (72), Expect = 0.21 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +3 Query: 132 IGKTLQRHPFSGLVAS 179 IG TL+RHPFSGLVAS Sbjct: 22 IGATLERHPFSGLVAS 37 >SB_32500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_24543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_5288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_4968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_3995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTKNSHSLSGF 45 >SB_1350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_59236| Best HMM Match : Attractin (HMM E-Value=8.2) Length = 125 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 84 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 124 >SB_53668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_53194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_47973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_40285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_16426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_15603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 127 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSLSGF 167 >SB_19187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/41 (51%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNHAFGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.5 bits (93), Expect = 6e-04 Identities = 20/41 (48%), Positives = 23/41 (56%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN +GSS A SAYQ WPT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAYGSSRIASSAYQKWPTRNSHSLSGF 45 >SB_11440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/53 (47%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +2 Query: 227 HRP-AVMSDQP--FHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 H P A S+QP F G LN FGSS A SA Q WPT + H +SGF Sbjct: 50 HAPQAPRSEQPTPFVGSDERRLWHLNRAFGSSRIASSALQKWPTRNSHSLSGF 102 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -3 Query: 254 VGRSXQQDGGHGSRNPLRSVQRL 186 VG S QQDGGHGS NPLR QRL Sbjct: 23 VGCSRQQDGGHGSWNPLRKGQRL 45 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 37.5 bits (83), Expect = 0.010 Identities = 20/41 (48%), Positives = 22/41 (53%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQISGF 376 PF G LN FGSS A SAYQ PT + H +SGF Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKGPTRNSHSLSGF 45 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 37.1 bits (82), Expect = 0.013 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 Query: 219 KSESAKECATTHHPKQPALKM 157 K ESAKEC TTH PKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.023 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPTWHRHQI 367 PF G LN FGSS A SAYQ WPT + H + Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPTRNSHSL 42 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.16 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWPT 349 PF G LN FGSS A SAYQ WPT Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQKWPT 36 >SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2306 Score = 31.1 bits (67), Expect = 0.86 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 Query: 634 GKP*WRTVSDSNVPNRSSETGYRGERTNRTHLVAGSV 524 G P WR S + PNR S+T YR T +V + Sbjct: 2250 GAPRWRPSSLAKAPNRCSQTNYRSTTRTNTLVVCRQI 2286 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 7/56 (12%) Frame = +3 Query: 279 FLGALTLRLVHPXAPFLLTKI-------GPLGTVIRSPASSFE*AGVLTHLKFENR 425 F+G+ RL HP F ++I GP T I P + + G+LT+LKFENR Sbjct: 63 FVGSDERRLWHPYRAFGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFENR 117 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 254 PFHGVP*AFFRRLNTTFGSSXSAISAYQNWP 346 PF G LN FGSS A SAYQN P Sbjct: 5 PFVGSDERRLWHLNRAFGSSRIASSAYQNGP 35 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 259 KGLVAHXSRTVAMEVGIR 206 K LVA SRTVAMEVGIR Sbjct: 16 KVLVALDSRTVAMEVGIR 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,342,755 Number of Sequences: 59808 Number of extensions: 463667 Number of successful extensions: 1012 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1010 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -