BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0035 (682 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 32 0.40 At3g21150.1 68416.m02672 zinc finger (B-box type) family protein... 28 6.6 At3g48010.1 68416.m05234 cyclic nucleotide-regulated ion channel... 27 8.7 At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 27 8.7 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 27 8.7 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 31.9 bits (69), Expect = 0.40 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -2 Query: 123 VTGTCDAKFLIW-YH*AVTSRTCATESAEGSG 31 VTG+ D+ L+W H A TSRT +E + GSG Sbjct: 2684 VTGSRDSTVLLWRIHKAFTSRTSVSEPSTGSG 2715 >At3g21150.1 68416.m02672 zinc finger (B-box type) family protein contains Pfam profile:PF01760 CONSTANS family zinc finger Length = 225 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/24 (50%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = +1 Query: 202 LSGFRLPWPP--SCCXERPTLSWC 267 +SG LPWPP +CC E + S C Sbjct: 58 VSGPLLPWPPRTTCCSESSSSSCC 81 >At3g48010.1 68416.m05234 cyclic nucleotide-regulated ion channel, putative (CNGC16) similar to cyclic nucleotide and calmodulin-regulated ion channel (cngc6) GI:4581207 from [Arabidopsis thaliana] Length = 705 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 7/48 (14%) Frame = -2 Query: 222 WKSESAKECATTHHPKQPALKMD-------GAEAFCLYTTVTGTCDAK 100 W+ E KE TH P L +D G +A+ T V CDA+ Sbjct: 250 WRRECIKEMNATHSPSCSLLFLDCGSLHDPGRQAWMRITRVLSNCDAR 297 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +3 Query: 345 PLGTVIRSPASSFE*AGVLTHLKFENRLRXFR 440 P +V + PAS+FE + V T +FE R FR Sbjct: 282 PKKSVRKVPASNFESSSVQTSFEFEKPKRSFR 313 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/47 (38%), Positives = 22/47 (46%) Frame = +3 Query: 282 LGALTLRLVHPXAPFLLTKIGPLGTVIRSPASSFE*AGVLTHLKFEN 422 LG+ T R V+ LL + GTVIRS S+ GV H N Sbjct: 881 LGSRTERPVNVSLDMLLKLVAVFGTVIRSTVSAPRIVGVDLHANERN 927 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,768,940 Number of Sequences: 28952 Number of extensions: 337356 Number of successful extensions: 688 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 668 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -