BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0034 (700 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 3.2 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 4.2 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 5.5 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.2 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +3 Query: 513 ILQRMGLHMATTTTVRTLHISLIAHIIRLHSMFYVHEYRNSDKPL 647 + + LH ATT ISL I+RL S+ + + N + L Sbjct: 304 VFESFYLHKATTLETVYYFISLGLLILRLVSVCFYGSWINEESKL 348 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.2 bits (45), Expect = 4.2 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +1 Query: 448 DLEVSQVIPHRATNPATSHIVPYSNVWVFTWLQQLRFARYIYPSS 582 DL +V + T+ TS +VP ++W + FA P + Sbjct: 31 DLSTFRVPTYGTTSHPTSKLVPPDERITYSWTEINAFANVSPPKT 75 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 5.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +1 Query: 448 DLEVSQVIPHRATNPATSHIVPYSNVWVFTWLQQLRFARYIYPS 579 DL +V + T+ TS +VP ++W + FA + PS Sbjct: 31 DLSTFRVPTYGTTSHPTSKLVPPDERITYSWTEINAFAN-VSPS 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,382 Number of Sequences: 336 Number of extensions: 2801 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -