BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0034 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0117 + 20302795-20304816 29 2.7 08_01_0238 - 1988688-1988830,1988989-1989257,1989339-1989600,198... 29 2.7 >11_06_0117 + 20302795-20304816 Length = 673 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = +1 Query: 430 QYLDCQDLEVSQVIPHRATNPATSHIVPYSNVWV----FTWLQQLRFARYIYPSSLIL 591 QYLD L + ++P++ N + + S + +WL +L++ +Y+Y SS+ L Sbjct: 151 QYLDLSGLGFTGMVPYQLGNLSKLEFLDLSGTGMQSADISWLTRLQWLKYLYLSSVNL 208 >08_01_0238 - 1988688-1988830,1988989-1989257,1989339-1989600, 1989693-1989805,1990560-1990594,1990771-1990878, 1992178-1992483 Length = 411 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -2 Query: 498 CSWVCSPMRYNLAYFQILTIQILMKGSLVCFLI 400 C+WV S N Y LT+ ++ S+VCF I Sbjct: 101 CTWVLSSKEINFPYPVALTLLHMVFSSVVCFAI 133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,170,922 Number of Sequences: 37544 Number of extensions: 281579 Number of successful extensions: 639 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 639 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -