BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0033 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 25 2.4 EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. 24 5.5 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 24 5.5 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 23 9.7 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 9.7 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +3 Query: 75 RERLIRPTKPAISIRCKTVGLIRRGKRRIRH*APNAG 185 R+RL+ A+ R TV + RG R+R A N G Sbjct: 572 RQRLLSRNTVALPPRKDTVSIPSRGYARVRFRADNPG 608 >EF117200-1|ABL67437.1| 421|Anopheles gambiae serpin 1 protein. Length = 421 Score = 23.8 bits (49), Expect = 5.5 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 164 ALSTECRMRREH-RXRSTTALASSISWRVTREVF 262 ++ T RR H R +S+ S W + REVF Sbjct: 20 SIGTVQPFRRHHLRHQSSFVSRSDFDWNLAREVF 53 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 Query: 68 PAFYALLRNTLVLDTL 21 PAFY LR+TLV + L Sbjct: 695 PAFYFALRDTLVAENL 710 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 23.0 bits (47), Expect = 9.7 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 520 LSCAISALPAPGRARSGHFPGHLPNLCGL 434 L + LP P S PG++PNL L Sbjct: 349 LPVVTAPLPGPSPPSSLGMPGNIPNLSQL 377 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 23.0 bits (47), Expect = 9.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 706 GRNGLPGLAPPRALTACP 653 G GLPGLA P + P Sbjct: 728 GDKGLPGLAGPAGIPGAP 745 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,940 Number of Sequences: 2352 Number of extensions: 12521 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -