BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0033 (728 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 25 0.55 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 25 0.73 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.2 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.8 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 25.4 bits (53), Expect = 0.55 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 50 VMRKMPDAARTPYPAYKTSNFNTL*NCRPDKTR*ASHQALSTECRM 187 +M K+P RTP +Y S F L N + + + A + C M Sbjct: 530 IMSKLPKTVRTPTDSYIRSFFELLQNPKVSNEQFLNTAATLSFCEM 575 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 566 LSDVLFTVTGTVLTQFILCYFSVACAW 486 + ++ + + GT+L +ILCYF C W Sbjct: 169 VGNIRWELAGTLLLVWILCYF---CIW 192 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 578 GCFRLSDVLFTVTGTVLTQFILCYFSVACAW 486 G + + + + GT+ +I+CYF C W Sbjct: 198 GIENIGSIRWELAGTLAVVWIMCYF---CIW 225 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -1 Query: 578 GCFRLSDVLFTVTGTVLTQFILCYFSVACAW 486 G + + + + GT+ +I+CYF C W Sbjct: 251 GIENIGSIRWELAGTLAVVWIMCYF---CIW 278 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 Query: 505 SALPAPGRARSGHFP 461 SA P+PG GH P Sbjct: 112 SASPSPGMGHMGHTP 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,756 Number of Sequences: 438 Number of extensions: 3868 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -