BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0032 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0792 - 23191120-23191313,23191419-23191775,23192027-231921... 29 4.7 09_02_0167 + 5221910-5222516,5222826-5224642 29 4.7 >12_02_0792 - 23191120-23191313,23191419-23191775,23192027-23192108, 23192186-23193097,23193190-23193346,23193540-23193694, 23194667-23194819,23195334-23195627,23195711-23195896, 23196062-23196662,23196868-23196992,23197101-23197197, 23197299-23197411,23198129-23198233 Length = 1176 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +3 Query: 291 LVLSQNTLTRQYLFIMYHMRQRPLSVKSTRKVVL*VKNIDTYVH 422 L++S + L + +M + LS++ +RK+++ ++D+YVH Sbjct: 587 LIISGRDAQQNELIVKRYMSKGDLSLRFSRKLLVYFASLDSYVH 630 >09_02_0167 + 5221910-5222516,5222826-5224642 Length = 807 Score = 28.7 bits (61), Expect = 4.7 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 81 DNLTDCLTQDGYKQTLSFLKIIGLYNL 161 +NLT +DG Q+L+F+ +IGL NL Sbjct: 735 ENLTWIEMEDGTMQSLNFIALIGLRNL 761 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,018,159 Number of Sequences: 37544 Number of extensions: 257822 Number of successful extensions: 521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -