BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0032 (696 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 28 8.3 >SB_47596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 211 DHSLQYHFKLH*LQHHTKLYKP 146 +HSLQ+H +H Q HT+L P Sbjct: 192 EHSLQFHRAVHPEQRHTRLRTP 213 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +3 Query: 51 RNVVSFCKLPDNLTDCLTQDGYKQTLSFLKIIGLYNLV*C 170 R V SFC LP L + Y TLSF +++ + + C Sbjct: 70 RLVSSFCVLPSPLVSETVTEPYNATLSFHQLVDVADAAIC 109 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,362,561 Number of Sequences: 59808 Number of extensions: 329016 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -