BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0032 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 26 0.99 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.0 AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 9.2 AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 23 9.2 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 26.2 bits (55), Expect = 0.99 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 114 THL-ESDSLLNYQGVYKMKQHFFLCRNNKN 28 THL E DS L + + + K HF++C + KN Sbjct: 607 THLLEQDSDLIWSVIGENKGHFYICGDAKN 636 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 Query: 410 YICTRFVQPNYLKLMCKCSTS 472 YI PN LKL+ C TS Sbjct: 886 YIMASVEHPNLLKLLAVCMTS 906 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 512 LIVKLYMRLSRLLNLTREPQLPVMN 586 ++VKL +RLS+L++L + Q+ N Sbjct: 61 VLVKLGLRLSQLIDLNLKDQILTTN 85 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 555 KFRRRLRRIYSFTIRKTMQSYFSQSFVQLVLHLHMSL 445 +FR+ + + M+++ + S+ LV +LHM + Sbjct: 205 EFRKYGNKAFELNTMIMMKTFLASSYPTLVRNLHMKI 241 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,392 Number of Sequences: 2352 Number of extensions: 11272 Number of successful extensions: 17 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -