BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0032 (696 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 25 0.69 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 3.7 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 4/39 (10%) Frame = +2 Query: 512 LIVKLYMRLSRLLNLTREPQLPVMN----HRSMEY*LQW 616 ++VKL +RLS+L++L + Q+ N H ++ QW Sbjct: 46 VVVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFQW 84 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 120 AYTHLESDSLLNYQGVYKMKQHFFLCR 40 AYT + S+ L Q V + ++ F+LC+ Sbjct: 761 AYTKILSNGTLLLQHVKEDREGFYLCQ 787 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 120 AYTHLESDSLLNYQGVYKMKQHFFLCR 40 AYT + S+ L Q V + ++ F+LC+ Sbjct: 757 AYTKILSNGTLLLQHVKEDREGFYLCQ 783 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,660 Number of Sequences: 438 Number of extensions: 3051 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -