BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0031 (644 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) 76 3e-14 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) 47 1e-05 SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) 46 3e-05 SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) 44 1e-04 SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) 44 1e-04 SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) 42 3e-04 SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 3e-04 SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) 42 3e-04 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) 41 7e-04 SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) 39 0.003 SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) 38 0.005 SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) 37 0.016 SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) 37 0.016 SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) 34 0.086 SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) 34 0.11 SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) 33 0.15 SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) 33 0.15 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) 28 5.7 SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_12646| Best HMM Match : SSrecog (HMM E-Value=0) Length = 783 Score = 75.8 bits (178), Expect = 3e-14 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +2 Query: 32 KKVKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDKTEW 199 KK K + PKR MSAYMLWLN R++ K +NPG+ V E++K GE+WK++ DK++W Sbjct: 534 KKKKDPNAPKRAMSAYMLWLNDTRQEIKDKNPGISVTEVSKVAGEMWKNLTDKSKW 589 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 38 VKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKD 187 VK + KRPM+A+M+W R + ENP + EI+K+ G WK + D Sbjct: 321 VKPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 370 >SB_33348| Best HMM Match : HMG_box (HMM E-Value=3.2e-34) Length = 179 Score = 47.2 bits (107), Expect = 1e-05 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 38 VKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKD 187 VK + KRPM+A+M+W R + ENP + EI+K+ G WK + D Sbjct: 4 VKPVEHVKRPMNAFMVWSREERRKIAQENPKMHNSEISKRLGSEWKQLAD 53 >SB_21901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 2/59 (3%) Frame = +2 Query: 29 RKKVKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM--KDKTEW 199 +K+ K +KPKR +SAY ++N R+ K +NP ++K GE+W M DKT++ Sbjct: 93 KKQTKDPNKPKRCLSAYFHFINLKRDDVKKDNPNASGGALSKVLGEMWSKMTDDDKTQY 151 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 2/88 (2%) Frame = +2 Query: 41 KMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM--KDKTEWXXXXX 214 K +KPK SAY +L RE+ + E + + +K E WK+M ++K + Sbjct: 7 KDPNKPKGAKSAYNFFLQDQREKLQREEGKFSLADFSKVSAEKWKNMSEEEKETFVQKAG 66 Query: 215 XXXXXXXXDLESYMPMAVVAKGAKRRLK 298 +++SY P G K+R K Sbjct: 67 KDKERFKEEMQSYTPPPSEESGKKKRKK 94 >SB_13764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1099 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/52 (34%), Positives = 30/52 (57%) Frame = +2 Query: 35 KVKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 K D+ KRPM+A+M+W R + +NP + EI+K+ G WK + ++ Sbjct: 782 KANSADRVKRPMNAFMVWSRERRRKMAQDNPKMHNSEISKRLGSEWKLLSEQ 833 >SB_53304| Best HMM Match : HMG_box (HMM E-Value=1.9e-32) Length = 398 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/49 (40%), Positives = 31/49 (63%), Gaps = 2/49 (4%) Frame = +2 Query: 47 TDKP--KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKD 187 T KP KRPM+A+M+W +AR + + P L E++K G++WK + D Sbjct: 59 TQKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWKLLND 107 >SB_18968| Best HMM Match : HMG_box (HMM E-Value=1.2e-19) Length = 1204 Score = 43.6 bits (98), Expect = 1e-04 Identities = 15/54 (27%), Positives = 34/54 (62%) Frame = +2 Query: 29 RKKVKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 ++K K+ +P +P+SAY ++ + + +NP + EIAK G++W+++ ++ Sbjct: 916 KRKTKIEGEPPKPLSAYQIFFKETQAAIRLQNPSAQFGEIAKIVGQMWENLPEE 969 >SB_23256| Best HMM Match : HMG_box (HMM E-Value=3.3e-22) Length = 523 Score = 43.6 bits (98), Expect = 1e-04 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +2 Query: 29 RKKV-KMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 RKK K + PK P++ Y+ +LN RE+ +SENP L E+ + G +W + Sbjct: 167 RKKAHKDVNAPKAPLTGYVRFLNEHREKVRSENPDLPFHEVTRILGNMWSQL 218 >SB_41131| Best HMM Match : HMG_box (HMM E-Value=4.1e-28) Length = 245 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +2 Query: 50 DKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKD 187 D KRP++++M+W R ENP +R EI+K G+ W+ M + Sbjct: 8 DHVKRPLNSFMVWAKEKRRAMNRENPKMRNAEISKILGDEWRKMPE 53 >SB_25642| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 267 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 KRPM+A+M+W + R Q +ENP L +I+K G W+ + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_10678| Best HMM Match : HMG_box (HMM E-Value=1.3e-29) Length = 494 Score = 42.3 bits (95), Expect = 3e-04 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 KRPM+A+M+W + R Q +ENP L +I+K G W+ + Sbjct: 8 KRPMNAFMIWSSKKRRQLAAENPKLHNSQISKMLGTEWRKL 48 >SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 709 Score = 41.5 bits (93), Expect = 6e-04 Identities = 16/47 (34%), Positives = 29/47 (61%) Frame = +2 Query: 41 KMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 K K KRPM+++M+W SAR + + P + E++K G++W+ + Sbjct: 106 KKDPKVKRPMNSFMVWAQSARRKLAEQYPHVHNAELSKMLGKLWRML 152 >SB_29734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 32 KKVKMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKD 187 KK KRPM+A+M+W R + E+P + EI+K+ G+ WK + + Sbjct: 37 KKKSDMQHVKRPMNAFMVWSQIERRKMAEEHPDMHNAEISKRLGKRWKLLSE 88 >SB_26162| Best HMM Match : HMG_box (HMM E-Value=1.5e-31) Length = 367 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 KRPM+++M+W R + ENP L EI+K G+ W + K Sbjct: 95 KRPMNSFMIWAKVMRRKFAEENPKLHNAEISKLLGKAWNELTTK 138 >SB_31139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 KRPM+A+M+W R E P + EI+K G WK+MKD+ Sbjct: 10 KRPMNAFMVWSKERRRIKSQECPRMHNSEISKILGCEWKAMKDE 53 >SB_37758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 382 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/54 (40%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +2 Query: 29 RKKVKMTDKPKRPMSAYMLW---LNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 RKK +KPK P++ Y+ + LNS RE K ++P L EI K G+ W S+ Sbjct: 185 RKKEYDLNKPKAPVTGYVHYVRFLNSRRESVKHQHPHLTFPEITKMLGQEWNSL 238 >SB_3516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 642 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 47 TDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 T++ KRPM+A+M+W R + NP L E++K G W+++ Sbjct: 363 TERIKRPMNAFMVWAQVERRRLADANPELHNAELSKMLGLTWRAL 407 >SB_24989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +2 Query: 41 KMTDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 K D KRPM+AYM+W R + E P + EI+K+ G W S+ Sbjct: 3 KPGDHIKRPMNAYMVWSRKERRRIAEECPRMLNSEISKRLGLEWNSL 49 >SB_40969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 KRPM+ +M+W R Q ENPG+ ++K G WK + Sbjct: 9 KRPMNCFMVWSREKRCQILQENPGINNARLSKLLGMAWKKL 49 >SB_16422| Best HMM Match : HMG_box (HMM E-Value=8.7e-26) Length = 245 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/48 (31%), Positives = 30/48 (62%) Frame = +2 Query: 47 TDKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 ++K KRP++A++LW R +ENP + +I++K G W+ + ++ Sbjct: 16 SEKIKRPLNAFILWSKKRRRVIANENPQMHNFDISRKLGLEWQKLTEE 63 >SB_2908| Best HMM Match : HMG_box (HMM E-Value=1.5e-08) Length = 324 Score = 38.3 bits (85), Expect = 0.005 Identities = 13/44 (29%), Positives = 27/44 (61%) Frame = +2 Query: 56 PKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKD 187 P++P+ YM + +Q K++NP ++ +I K G++W+ + D Sbjct: 28 PEKPLMPYMRYSRKVWDQVKNQNPDFKLWDIGKIIGQMWRDLDD 71 >SB_52386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 36.7 bits (81), Expect = 0.016 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +2 Query: 53 KPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDKTE 196 K KRPM+A+M+W R P EI+ + GEIW + + + Sbjct: 100 KVKRPMNAFMIWARLHRSTIAKRYPQANNAEISIRLGEIWNDLSSEQQ 147 >SB_1832| Best HMM Match : HMG_box (HMM E-Value=1.7e-22) Length = 299 Score = 36.7 bits (81), Expect = 0.016 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +2 Query: 65 PMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 P+SA+ LW N AR+ NP + ++ KK WK + +K Sbjct: 230 PLSAFELWANQARKDLLVSNPDISAKKLKKKLKRKWKEIDEK 271 Score = 32.3 bits (70), Expect = 0.35 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +2 Query: 50 DKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 ++PK P+++Y + R + + P L+ E+A K + W+ M ++ Sbjct: 150 NQPKMPLTSYFRYCQKHRAKLAKKYPNLKSTELAAKLSKKWRKMSEE 196 >SB_16438| Best HMM Match : HMG_box (HMM E-Value=7.2e-31) Length = 690 Score = 36.7 bits (81), Expect = 0.016 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 2/65 (3%) Frame = +2 Query: 2 KNYFKIFAIRKKVKMTDKPKRPMSAYMLWLNSAREQ--XKSENPGLRVXEIAKKGGEIWK 175 + Y K K DKPKRP +AY L+L + R++ K+ G ++ +A GE W+ Sbjct: 559 QRYLKESGKNDPKKDPDKPKRPPTAYFLFLAAFRKEMAGKALEDGKKIPSLA---GERWR 615 Query: 176 SMKDK 190 M D+ Sbjct: 616 EMSDE 620 Score = 31.9 bits (69), Expect = 0.46 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = +2 Query: 29 RKKVKMTDKP--KRPMSAYMLWLNSAREQXKSEN-----PGLRVXEIAKKGGEIWKSMKD 187 RKK D P KR SAY+ + + R + K+++ P + E+AK GE WK + D Sbjct: 485 RKKKAKGDGPVVKRASSAYIHFTSDFRAKLKAKSAKSGTPLPKANEVAKLAGEEWKKLND 544 Query: 188 K 190 + Sbjct: 545 E 545 >SB_27742| Best HMM Match : HMG_box (HMM E-Value=1.3e-24) Length = 201 Score = 34.3 bits (75), Expect = 0.086 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMKDK 190 KRPM+A+M+W + R + + P + EI+K G W + ++ Sbjct: 10 KRPMNAFMVWSRTERRKLALKYPNMLNCEISKLLGAEWSRLSEE 53 >SB_8014| Best HMM Match : HMG_box (HMM E-Value=0.00031) Length = 406 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = +2 Query: 50 DKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMK--DKTEW 199 D+ + + + LWL R+Q + ENP + ++ K + WK + +K W Sbjct: 327 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGLDSVEKKVW 378 >SB_57274| Best HMM Match : HMG_box (HMM E-Value=0.021) Length = 200 Score = 33.5 bits (73), Expect = 0.15 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 50 DKPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 D+ + + + LWL R+Q + ENP + ++ K + WK + Sbjct: 34 DRQTKKKNGFSLWLEENRDQIEEENPDIPDEDVVKIAMKTWKGL 77 >SB_16481| Best HMM Match : HMG_box (HMM E-Value=1.2e-08) Length = 271 Score = 33.5 bits (73), Expect = 0.15 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSM 181 K PM+A+M+ R+ S NPG+ E +K G WK + Sbjct: 10 KSPMNAFMVCSRGKRKHYASINPGMHNSEFSKSLGPEWKML 50 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 Query: 53 KPKRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKSMK 184 K KRP A+ + ++ K ENP L+ EI K + W +++ Sbjct: 305 KHKRPTPAFFRFRQDYADKVKEENPHLKDAEIRKHLSDQWANLE 348 >SB_46509| Best HMM Match : HMG_box (HMM E-Value=4.2e-10) Length = 145 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKS 178 KR S Y+L+ + R + E+P EI++ GE W++ Sbjct: 36 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 75 >SB_12182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1361 Score = 28.3 bits (60), Expect = 5.7 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 59 KRPMSAYMLWLNSAREQXKSENPGLRVXEIAKKGGEIWKS 178 KR S Y+L+ + R + E+P EI++ GE W++ Sbjct: 1269 KRGQSGYLLFSHEMRGIIRKEHPEYAFGEISRLIGEEWRN 1308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,902,599 Number of Sequences: 59808 Number of extensions: 243695 Number of successful extensions: 562 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -