BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0030 (599 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0UUU7 Cluster: Aldo/keto reductase; n=2; Clostridiacea... 32 9.0 >UniRef50_A0UUU7 Cluster: Aldo/keto reductase; n=2; Clostridiaceae|Rep: Aldo/keto reductase - Clostridium cellulolyticum H10 Length = 365 Score = 32.3 bits (70), Expect = 9.0 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Frame = -1 Query: 296 E*SLTNYNLETS*LIKFHIILLLEMYRTRLAR-----PALDDKDRGVRSALHIVFSHSNC 132 E SL NLE IL L+ YR+R+ + AL K+ G+ HIVFS ++C Sbjct: 95 ETSLKRMNLEKINFFHIWCILSLDDYRSRMVKGGAYEAALKAKEEGLIE--HIVFS-THC 151 Query: 131 INSKLINFTGE-CYKGLT 81 ++ E C++G+T Sbjct: 152 TGDEIETIVNEGCFEGMT 169 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,713,032 Number of Sequences: 1657284 Number of extensions: 8617207 Number of successful extensions: 16634 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16257 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16632 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 42317807226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -