BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0030 (599 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF124164-1|AAD44113.1| 128|Homo sapiens lambda 1 immunoglobin l... 29 9.4 AF054637-1|AAC97078.1| 128|Homo sapiens lambda 1 immunoglobulin... 29 9.4 >AF124164-1|AAD44113.1| 128|Homo sapiens lambda 1 immunoglobin light chain variable region protein. Length = 128 Score = 29.5 bits (63), Expect = 9.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 428 RRATYSISAQYTKIHQRYQSFNKHIPRATPR 336 ++ T S S Y+ I + Y S+ +HIP PR Sbjct: 16 QKVTISCSGSYSNIGKNYVSWYQHIPGTAPR 46 >AF054637-1|AAC97078.1| 128|Homo sapiens lambda 1 immunoglobulin light chain variable region protein. Length = 128 Score = 29.5 bits (63), Expect = 9.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 428 RRATYSISAQYTKIHQRYQSFNKHIPRATPR 336 ++ T S S Y+ I + Y S+ +HIP PR Sbjct: 16 QKVTISCSGSYSNIGKNYVSWYQHIPGTAPR 46 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,082,143 Number of Sequences: 237096 Number of extensions: 1227572 Number of successful extensions: 1579 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6297951520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -