BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0030 (599 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88180-2|AAB42298.3| 355|Caenorhabditis elegans Hypothetical pr... 28 5.9 AC024859-7|AAK29968.1| 550|Caenorhabditis elegans Hypothetical ... 27 7.7 >U88180-2|AAB42298.3| 355|Caenorhabditis elegans Hypothetical protein T27A3.5 protein. Length = 355 Score = 27.9 bits (59), Expect = 5.9 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +1 Query: 64 PKISYYVKPL*HSPVKFISFEFIQFECEKTMCNADRTPRSLSSKAGRANRVLYISSKRII 243 P + +VK + VK +S EF+ + E CN +T + R V I R++ Sbjct: 57 PILRDFVKATIQTGVKQLSTEFLNLKMETQPCNKPKTGHEGHPEKNRYKDVYCIDDTRVV 116 >AC024859-7|AAK29968.1| 550|Caenorhabditis elegans Hypothetical protein Y71H2AM.13 protein. Length = 550 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 397 YCADIEYVALRHIT*SFKLNE*D 465 +C DI YV HI SF NE D Sbjct: 449 HCTDISYVVGNHIVNSFDFNEED 471 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,002,670 Number of Sequences: 27780 Number of extensions: 221804 Number of successful extensions: 419 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 417 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -