SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0026
         (693 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive pep...    23   2.4  
AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    22   5.5  
AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory recept...    22   5.5  
AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory recept...    21   9.6  

>EF222291-1|ABN79651.1|  374|Tribolium castaneum cardioactive
           peptide receptor 1 protein.
          Length = 374

 Score = 23.0 bits (47), Expect = 2.4
 Identities = 15/42 (35%), Positives = 20/42 (47%)
 Frame = -3

Query: 475 NNTSNSTMNYFL*TDNYLKLVGTFTKTIYYNMSFLFTLNGGR 350
           NNTS     YF  T+ +  L   F   +  N+  L+TL  GR
Sbjct: 13  NNTSLDAF-YFFETEQFTLLWVLFVIIVAGNVGVLYTLLFGR 53


>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +3

Query: 453 IVLFDVLFQTPYL 491
           + LFDVLFQ  YL
Sbjct: 261 VSLFDVLFQAYYL 273


>AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory receptor
           candidate 11 protein.
          Length = 344

 Score = 21.8 bits (44), Expect = 5.5
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = +3

Query: 453 IVLFDVLFQTPYL 491
           + LFDVLFQ  YL
Sbjct: 261 VSLFDVLFQAYYL 273


>AM292362-1|CAL23174.2|  398|Tribolium castaneum gustatory receptor
           candidate 41 protein.
          Length = 398

 Score = 21.0 bits (42), Expect = 9.6
 Identities = 9/34 (26%), Positives = 18/34 (52%)
 Frame = -2

Query: 494 TQIRCLKQHIK*YDELLSLNR*LFKIGGYFYKDY 393
           T  + L++ +  + E +   +  FK+GG+   DY
Sbjct: 338 TNEQLLRKELLLFAEQMGQRQVAFKVGGFLNIDY 371


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 161,171
Number of Sequences: 336
Number of extensions: 3611
Number of successful extensions: 6
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18218375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -