BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0026 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0171 + 20581995-20582354,20582509-20583141,20584954-20585058 29 3.5 02_04_0596 + 24195863-24196179,24196257-24196359 29 4.6 >02_04_0171 + 20581995-20582354,20582509-20583141,20584954-20585058 Length = 365 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 358 GGRGSTQGSAAMGPRVHAEVPATRDAARGHFRDTP 254 G GS+ SAA R + VP + AARG TP Sbjct: 192 GAVGSSSSSAAAAARANTVVPVPQRAARGATAPTP 226 >02_04_0596 + 24195863-24196179,24196257-24196359 Length = 139 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +2 Query: 323 HSRRPLGTPPASIQSK*KRHVVINSLCKSTH 415 HS+RP P A I++ RHV N++C+ T+ Sbjct: 25 HSQRP---PTAFIEAALARHVAFNAMCRRTN 52 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,163,747 Number of Sequences: 37544 Number of extensions: 340220 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -