BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0023 (692 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL033514-19|CAA22104.1| 696|Caenorhabditis elegans Hypothetical... 28 7.3 AF016422-4|AAG24172.1| 320|Caenorhabditis elegans Hypothetical ... 28 7.3 >AL033514-19|CAA22104.1| 696|Caenorhabditis elegans Hypothetical protein Y75B8A.19 protein. Length = 696 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -2 Query: 529 LPRTPTWPTRFGQRKVAAINSYLD 458 +P P RF R +AA+N YLD Sbjct: 14 MPENPRKKLRFTSRHIAAVNRYLD 37 >AF016422-4|AAG24172.1| 320|Caenorhabditis elegans Hypothetical protein R09E12.3 protein. Length = 320 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 512 RGSAREKACIHGKREQNGLNCKYADVFIAGPETNERARDGLPSVMGIN 655 +G R+ AC+ RE + Y D P +NE AR+G+ + + N Sbjct: 209 KGYIRKAACLVAMREWSKAQRAYEDALQVDP-SNEEAREGVRNCLRSN 255 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,293,749 Number of Sequences: 27780 Number of extensions: 324378 Number of successful extensions: 613 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 613 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -