BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0020 (603 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-tran... 26 1.1 AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-tran... 26 1.1 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 24 4.4 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 24 4.4 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 24 4.4 AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-tran... 24 4.4 AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-tran... 24 4.4 >AF071162-1|AAC79998.1| 216|Anopheles gambiae glutathione S-transferase D1-4 protein. Length = 216 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 45 ADVQVFEQVGKAPAANLPHVLRWYNQIASYTPAE--RKTWSQGTSP 176 A + FE G +A + +VLRWY + PA ++W++ P Sbjct: 165 ATLTTFEVAGYDFSAYV-NVLRWYKSMPELIPASDTNRSWAEAARP 209 >AF071160-2|AAC79994.1| 216|Anopheles gambiae glutathione S-transferase protein. Length = 216 Score = 25.8 bits (54), Expect = 1.1 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +3 Query: 45 ADVQVFEQVGKAPAANLPHVLRWYNQIASYTPAE--RKTWSQGTSP 176 A + FE G +A + +VLRWY + PA ++W++ P Sbjct: 165 ATLTTFEVAGYDFSAYV-NVLRWYKSMPELIPASDTNRSWAEAARP 209 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 505 NLQFIYAIPNRHKFGGSPEKAFHF-NSAYLVFHFLHI 398 NL + N H+FGG P + F SA V LH+ Sbjct: 334 NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHL 370 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 505 NLQFIYAIPNRHKFGGSPEKAFHF-NSAYLVFHFLHI 398 NL + N H+FGG P + F SA V LH+ Sbjct: 334 NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHL 370 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -3 Query: 505 NLQFIYAIPNRHKFGGSPEKAFHF-NSAYLVFHFLHI 398 NL + N H+FGG P + F SA V LH+ Sbjct: 220 NLALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHL 256 >AF071163-1|AAC79999.1| 218|Anopheles gambiae glutathione S-transferase D1-3 protein. Length = 218 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +3 Query: 9 EKSYVSGYTPSQADVQVFEQVGKAPAANLP-----HVLRWYNQIASYTPAERK 152 E+ G P+ AD + + AA ++ RWY Q + PA K Sbjct: 151 ERFVAGGDDPTIADFSILASIATFDAAGYDLRRYENIHRWYEQTGNIAPAADK 203 >AF071160-4|AAC79992.1| 218|Anopheles gambiae glutathione S-transferase protein. Length = 218 Score = 23.8 bits (49), Expect = 4.4 Identities = 14/53 (26%), Positives = 21/53 (39%), Gaps = 5/53 (9%) Frame = +3 Query: 9 EKSYVSGYTPSQADVQVFEQVGKAPAANLP-----HVLRWYNQIASYTPAERK 152 E+ G P+ AD + + AA ++ RWY Q + PA K Sbjct: 151 ERFVAGGDDPTIADFSILASIATFDAAGYDLRRYENIHRWYEQTGNIAPAADK 203 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,310 Number of Sequences: 2352 Number of extensions: 12547 Number of successful extensions: 30 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -