BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0019 (692 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g58920.1 68416.m06566 F-box family protein contains F-box dom... 28 5.1 At2g31170.1 68415.m03805 tRNA synthetase class I (C) family prot... 27 8.9 >At3g58920.1 68416.m06566 F-box family protein contains F-box domain Pfam:PF00646 Length = 470 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -3 Query: 423 FFPRVKLCILSSILFYQMRGCRVRQIY*ICFLVSSLGVGDIR 298 F P ++ L SI F +RGC + + C ++ +L + D++ Sbjct: 159 FLPGLESLFLKSIWFSDLRGCAFQTLLSACPVLKTLTIYDVQ 200 >At2g31170.1 68415.m03805 tRNA synthetase class I (C) family protein similar to cysteine-tRNA ligase [Escherichia coli] GI:41203; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 563 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +3 Query: 468 HSRKVTKQSDYEKSLKTL-TRIKNIVTI 548 H+RK KQ+ E+SLK L T I++++TI Sbjct: 448 HTRKGKKQARREESLKALETTIRDVLTI 475 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,795,229 Number of Sequences: 28952 Number of extensions: 234347 Number of successful extensions: 387 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -