BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0018 (595 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) 28 6.5 SB_28344| Best HMM Match : Ion_trans_2 (HMM E-Value=5.9e-38) 28 6.5 SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_32093| Best HMM Match : MCM (HMM E-Value=0.004) Length = 348 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 307 HSLATQTVLYETCYQILIQNTLLLGSLQTYHIR 209 H V+ TC + +QNT LLG + H R Sbjct: 262 HVTVQDAVVAVTCVECSMQNTALLGCMNALHTR 294 >SB_28344| Best HMM Match : Ion_trans_2 (HMM E-Value=5.9e-38) Length = 354 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 116 RFNTYDIICMITELQRLIGMRVNQVYDIDNRTYVIRL 226 RFNT+ + CM L+R +GM+ V N V L Sbjct: 167 RFNTF-LACMFRRLKRKLGMKATDVSSTTNLVVVCGL 202 >SB_58158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 883 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = -1 Query: 307 HSLATQTVLYETCYQILIQNTLLLGSLQTYHIR 209 H V+ TC + +QNT LLG + H R Sbjct: 277 HVTVQDAVVAVTCVECSMQNTALLGCMNALHTR 309 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,906,013 Number of Sequences: 59808 Number of extensions: 359189 Number of successful extensions: 720 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -