BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0016 (649 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0F382 Cluster: Putative uncharacterized protein; n=1; ... 36 0.64 >UniRef50_Q0F382 Cluster: Putative uncharacterized protein; n=1; Mariprofundus ferrooxydans PV-1|Rep: Putative uncharacterized protein - Mariprofundus ferrooxydans PV-1 Length = 225 Score = 36.3 bits (80), Expect = 0.64 Identities = 22/74 (29%), Positives = 43/74 (58%) Frame = +2 Query: 317 IVLPWLFWSGT*MKAIKLLYRHRSLMRV*VFNFFLLILNSVKITMKHFNKYKLKPCDQIK 496 ++LPWL W + IK L+ HR + + N L +L ++ +T+ F+ + ++P ++I Sbjct: 73 LLLPWLLW-----RVIKELHVHREVEPL--MNMPLTMLIALAVTL--FSFHIIQPIEKIS 123 Query: 497 TVKRRDNLAQSTKC 538 + RD++A +T C Sbjct: 124 ELLTRDSMAIATAC 137 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,563,575 Number of Sequences: 1657284 Number of extensions: 7668058 Number of successful extensions: 13870 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 13514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13868 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -