BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0016 (649 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-4133|AAN14111.1| 408|Drosophila melanogaster CG31060-P... 31 1.8 AE014296-2182|AAF49887.2| 3892|Drosophila melanogaster CG32113-P... 29 4.1 >AE014297-4133|AAN14111.1| 408|Drosophila melanogaster CG31060-PA protein. Length = 408 Score = 30.7 bits (66), Expect = 1.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 495 FIWSHGFSLYLLKCFIVIFTEFKIN 421 F W G+SLYL+ +++F EF N Sbjct: 43 FCWMAGYSLYLIAILLMVFYEFHAN 67 >AE014296-2182|AAF49887.2| 3892|Drosophila melanogaster CG32113-PA protein. Length = 3892 Score = 29.5 bits (63), Expect = 4.1 Identities = 17/52 (32%), Positives = 31/52 (59%) Frame = -2 Query: 492 IWSHGFSLYLLKCFIVIFTEFKINRKKLKTYTRIKDR*RYNNFIAFIQVPDQ 337 ++ H FS+ LLK +++ TE K+N + K+ ++NNF A++Q+ Q Sbjct: 478 VFGH-FSIKLLKGLVILQTEDKLNDGRNKSMEM-----QFNNFSAYLQLSPQ 523 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,731,346 Number of Sequences: 53049 Number of extensions: 356753 Number of successful extensions: 610 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2744900550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -