BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0013 (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.) 115 3e-26 SB_26423| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_51145| Best HMM Match : RCSD (HMM E-Value=1.3) 28 3.7 SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) 28 3.7 SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_31759| Best HMM Match : WD40 (HMM E-Value=0.59) 28 4.9 SB_19058| Best HMM Match : WD40 (HMM E-Value=0.59) 28 4.9 SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) 27 6.5 SB_37049| Best HMM Match : Acylphosphatase (HMM E-Value=0.82) 27 6.5 >SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 115 bits (276), Expect = 3e-26 Identities = 54/84 (64%), Positives = 59/84 (70%) Frame = +3 Query: 3 VIKKPVAVHSRARVRKNTEARRKGRHCGFGKRRGTANARMPQKELWXXXXXXXXXXXXXX 182 +IKKP VHSRARVRK EAR KGRH G GKR+GTANARMPQK +W Sbjct: 78 IIKKPEIVHSRARVRKADEARSKGRHSGHGKRKGTANARMPQKTIWIRRMRVLRRLLRKY 137 Query: 183 XTAKKIDRHLYHSLYMKAKGNVFK 254 AKKID H+YHSLYMK+KGNVFK Sbjct: 138 REAKKIDNHMYHSLYMKSKGNVFK 161 Score = 53.6 bits (123), Expect = 9e-08 Identities = 28/70 (40%), Positives = 39/70 (55%) Frame = +2 Query: 230 EGEG*CVQDKRVLMEYIHRKKAEKARTKMLSDQXXXXXXXXXXXXXXXXXXXXXXXXXLL 409 + +G ++KRVLMEYIH+KKAEKAR+K+LSDQ +L Sbjct: 154 KSKGNVFKNKRVLMEYIHKKKAEKARSKLLSDQAEARRNKNKAAKQRRDDRMEQKRKDML 213 Query: 410 QTFAREDEAA 439 +A+E+EAA Sbjct: 214 SAYAKEEEAA 223 >SB_26423| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 33 RARVRKNTEARRKGRHCGFGKRRGTANAR 119 +A RK RR+ R G K+R TANAR Sbjct: 17 KANSRKKRRRRRRPRLTGLSKQRQTANAR 45 >SB_51145| Best HMM Match : RCSD (HMM E-Value=1.3) Length = 248 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 403 FLLLGGNTFLAALAC 359 F L+GG TFLAALAC Sbjct: 70 FALMGGLTFLAALAC 84 >SB_3407| Best HMM Match : TPX2 (HMM E-Value=2.9e-09) Length = 787 Score = 28.3 bits (60), Expect = 3.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 387 PPRRRNCCRPSLEKTKPRLPLRSK 458 PP +N +P ++KTKP PL ++ Sbjct: 199 PPSEKNAFQPPMKKTKPSSPLLTR 222 >SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 210 DACQSSWQFCTSGAIFLEPF-VFVPIVPSVAYAHW 109 D + S Q C FLEP VF P+ PS A+AH+ Sbjct: 192 DIVEKSQQACREHEAFLEPMGVFSPLPPS-AHAHF 225 >SB_31759| Best HMM Match : WD40 (HMM E-Value=0.59) Length = 752 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 303 AFSAFFLWMYSMSTRLS*THYPS 235 +F AFF W+YS+ RLS PS Sbjct: 414 SFKAFFQWLYSIILRLSDEPVPS 436 >SB_19058| Best HMM Match : WD40 (HMM E-Value=0.59) Length = 752 Score = 27.9 bits (59), Expect = 4.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 303 AFSAFFLWMYSMSTRLS*THYPS 235 +F AFF W+YS+ RLS PS Sbjct: 414 SFKAFFQWLYSIILRLSDEPVPS 436 >SB_35269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 162 LEPFVFVPIVPSVAY--AHWQYLFSXQSHSDDPFYVPLCFCGH 40 ++ + F+P V + W++ + H+DDPF V C H Sbjct: 72 IKDYSFLPCCFKVCHRTCFWRWAHNHSIHADDPFEVACPHCRH 114 >SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) Length = 1206 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 225 RVSGIDACQSSWQFCTSGAIFLEPFVF 145 RV+G+ S WQ CT+ A L+ VF Sbjct: 493 RVAGVKKSPSRWQQCTNAANNLDGLVF 519 >SB_37049| Best HMM Match : Acylphosphatase (HMM E-Value=0.82) Length = 646 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -1 Query: 162 LEPFVFVPIVPSVAY--AHWQYLFSXQSHSDDPFYVPLCFCGH 40 ++ + F+P V + W++ + H+DDPF V C H Sbjct: 72 IKDYSFLPCCFKVCHRTCFWRWAHNHSIHADDPFEVACPHCRH 114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,907,355 Number of Sequences: 59808 Number of extensions: 265603 Number of successful extensions: 818 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -