BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0013 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 26 0.25 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 26 0.25 S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. 22 4.1 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 21 5.4 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 7.1 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.8 bits (54), Expect = 0.25 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 384 LPPRRRNCCRPSLEKTKPRLPLRSK 458 + PR++NCCR L K P RSK Sbjct: 393 MQPRKKNCCRSWLSK----FPTRSK 413 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 25.8 bits (54), Expect = 0.25 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 384 LPPRRRNCCRPSLEKTKPRLPLRSK 458 + PR++NCCR L K P RSK Sbjct: 393 MQPRKKNCCRSWLSK----FPTRSK 413 >S78458-1|AAB34402.1| 46|Apis mellifera apamin protein. Length = 46 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -3 Query: 211 RCLSIFLAVLYFRSNFLRTLCLC 143 RC+ +FL+V+ S F+ + C Sbjct: 6 RCIYLFLSVILITSYFVTPVMPC 28 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 21.4 bits (43), Expect = 5.4 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = -1 Query: 324 SLSIFVLAFSAFFLWMYSMSTRLS*THYPSPSCRVSGIDACQSSWQ 187 +LSI A F+W+Y++S L +G +C SW+ Sbjct: 9 ALSIRHAVILASFVWIYALSLSLPPLFGWGSYGPEAGNVSCSVSWE 54 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.0 bits (42), Expect = 7.1 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -3 Query: 376 LAALACLLYFIAAGLSLVAKHLRPGL 299 L L+C+L+F+ + + ++R GL Sbjct: 205 LYQLSCILFFLIPMVFIAVLYIRIGL 230 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,824 Number of Sequences: 438 Number of extensions: 2757 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -