BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0011 (360 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0920 + 20826876-20829293 30 0.63 11_01_0523 - 4109070-4109984,4110532-4110936 26 7.7 >04_03_0920 + 20826876-20829293 Length = 805 Score = 29.9 bits (64), Expect = 0.63 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -2 Query: 149 LVSINDKLKLIFFSHGRLKTQTNTNPHFCIYFEKMA 42 LVS N K L FF G + TN N + I+F K++ Sbjct: 41 LVSNNSKFALGFFKPGNESSYTNHNSYLGIWFNKVS 76 >11_01_0523 - 4109070-4109984,4110532-4110936 Length = 439 Score = 26.2 bits (55), Expect = 7.7 Identities = 11/46 (23%), Positives = 25/46 (54%) Frame = +3 Query: 3 KLIPIKKVAVLDKSHFLKIYAKVWICICLSFQPPMTEKY*LQFIIN 140 ++ +K++ S F + A VW C C++ + P+ + ++F +N Sbjct: 233 QIATLKRICGGGASTFSAVTALVWQCACVARRLPLCSQTLVRFPVN 278 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,501,854 Number of Sequences: 37544 Number of extensions: 109752 Number of successful extensions: 191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 554421256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -