Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0011
         (360 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC073275-1|AAQ93366.1|  111|Homo sapiens unknown protein.              30   1.9  

>AC073275-1|AAQ93366.1|  111|Homo sapiens unknown protein.
          Length = 111

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 16/63 (25%), Positives = 29/63 (46%)
 Frame = -2

Query: 206 FCFLLFQNIISISDLI*YFLVSINDKLKLIFFSHGRLKTQTNTNPHFCIYFEKMAFIQNC 27
           FC + F N+     +     + I  +   I+F++ + K   NTN    +Y+  + F+  C
Sbjct: 22  FCRINFSNLELEGTIYVCVCIYIYKRKTYIYFNYLKCKNLPNTNGKSDVYYIILLFVHLC 81

Query: 26  HLF 18
            LF
Sbjct: 82  DLF 84


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 44,732,698
Number of Sequences: 237096
Number of extensions: 706143
Number of successful extensions: 857
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 855
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 857
length of database: 76,859,062
effective HSP length: 81
effective length of database: 57,654,286
effective search space used: 2190862868
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)