BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0011 (360 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42834-4|AAA83584.1| 2229|Caenorhabditis elegans Hypothetical pr... 27 3.9 AC024750-3|AAF60440.1| 384|Caenorhabditis elegans Hypothetical ... 26 9.1 >U42834-4|AAA83584.1| 2229|Caenorhabditis elegans Hypothetical protein F28B4.3 protein. Length = 2229 Score = 27.1 bits (57), Expect = 3.9 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -1 Query: 201 FSFVSEYNKHFRSNLILLGFY***IEVNIFQSWAVE 94 F +V YN FRS L L G Y NI++S AV+ Sbjct: 599 FFYVHMYNTLFRSQLALSGDYSHCANQNIYKSVAVD 634 >AC024750-3|AAF60440.1| 384|Caenorhabditis elegans Hypothetical protein Y17G9A.4 protein. Length = 384 Score = 25.8 bits (54), Expect = 9.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 18 KKVAVLDKSHFLKIYAKVWICICLSF 95 K+ HFL I A +W+C +SF Sbjct: 227 KQTGKHSSQHFLLILAFLWLCALISF 252 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,376,942 Number of Sequences: 27780 Number of extensions: 128258 Number of successful extensions: 201 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 492763868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -