BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0011 (360 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66980.1 68418.m08444 transcriptional factor B3 family protei... 27 3.8 At1g55325.1 68414.m06320 expressed protein 26 8.7 >At5g66980.1 68418.m08444 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 334 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 30 VLDKSHFLKIYAKVWICICLSFQPPMTEKY*LQFIINRN 146 +L+ K + W+C C S + +T K +FI+ N Sbjct: 265 ILNHDRGFKFSHESWLCFCKSHEMILTNKCLFEFIVPSN 303 >At1g55325.1 68414.m06320 expressed protein Length = 1921 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 137 NDKLKLIFFSHGRLKTQT 84 ND +K ++FS G LKT T Sbjct: 264 NDLVKQVYFSSGNLKTST 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,702,813 Number of Sequences: 28952 Number of extensions: 108632 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -