BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0009 (511 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 27 1.2 SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyce... 25 5.0 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 27.5 bits (58), Expect = 1.2 Identities = 16/26 (61%), Positives = 20/26 (76%), Gaps = 2/26 (7%) Frame = -1 Query: 445 YPIIFLD-SFR-GSHKLAQKENPLLI 374 +PI LD S R GS+KL++KENP LI Sbjct: 893 FPIDNLDMSMRTGSYKLSEKENPKLI 918 >SPAC3G6.11 |||ATP-dependent DNA helicase Chl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 844 Score = 25.4 bits (53), Expect = 5.0 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 469 SVRLLT*IYPIIFLDSFRGSHKLAQKENPLLINTSLNVL 353 S +++T YP++ +S R + L K+N +I+ + N++ Sbjct: 330 SAQIVTLPYPLLLQESARNALNLTLKDNICIIDEAHNLI 368 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,935,357 Number of Sequences: 5004 Number of extensions: 34168 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -