BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0009 (511 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 28 0.21 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 26 0.85 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 26 0.85 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 7.9 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 27.9 bits (59), Expect = 0.21 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 296 ATMRTTEKISHALHTKKKIYFIT*MGGXAH 207 A +TE + H LH ++++YF+ AH Sbjct: 173 AVRNSTEPVEHVLHLEEELYFLNIRTSMAH 202 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.8 bits (54), Expect = 0.85 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 241 YILLLRWVXELTSQLVVKWLLEPIDIYNVNAPPT 140 ++L L W E+ Q + L+E + Y N P T Sbjct: 943 HLLHLNWKHEVHRQSTIDVLIEDLHTYTFNPPET 976 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.8 bits (54), Expect = 0.85 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 241 YILLLRWVXELTSQLVVKWLLEPIDIYNVNAPPT 140 ++L L W E+ Q + L+E + Y N P T Sbjct: 944 HLLHLNWKHEVHRQSTIDVLIEDLHTYTFNPPET 977 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 22.6 bits (46), Expect = 7.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 60 GRNRQGGGTYPRGLTR 13 G+ Q GG YPRG R Sbjct: 253 GQYDQRGGNYPRGTER 268 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,790 Number of Sequences: 2352 Number of extensions: 7908 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46091631 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -