BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0005 (454 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 24 0.77 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 22 3.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 4.1 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 21 5.4 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 5.4 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 5.4 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 23.8 bits (49), Expect = 0.77 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 125 RFLKFTYKLKSNIMCKPC 178 +F+K T K MC+PC Sbjct: 113 KFIKVTTKAPLECMCRPC 130 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.8 bits (44), Expect = 3.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 99 IPVNGTRXRKKNVTFA 52 +PVNG K N+TF+ Sbjct: 210 LPVNGVTSEKCNLTFS 225 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 4.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 119 CFRFLKFTYKLKSNIMCKPCRLYR 190 CF KF S+I KP +LY+ Sbjct: 9 CFYVAKFFAITPSSIYDKPTKLYQ 32 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 104 IQFPLMERXLEKKT*HSLKYNEIPSIGHGTD 12 +QF L+E L + + +KYN+ S G D Sbjct: 76 LQFRLLENKLGVRQENRVKYNQNYSKVFGND 106 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 104 IQFPLMERXLEKKT*HSLKYNEIPSIGHGTD 12 +QF L+E L + + +KYN+ S G D Sbjct: 136 LQFRLLENKLGVRQENRVKYNQNYSKVFGND 166 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 104 IQFPLMERXLEKKT*HSLKYNEIPSIGHGTD 12 +QF L+E L + + +KYN+ S G D Sbjct: 136 LQFRLLENKLGVRQENRVKYNQNYSKVFGND 166 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,232 Number of Sequences: 336 Number of extensions: 2002 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10301074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -