BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0003 (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 26 0.17 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 26.2 bits (55), Expect = 0.17 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = +2 Query: 86 LLQWLQTVFAFCIC----TIFPLNQTYLVFWSAL 175 L+Q+ VFAFC C +I P++ FWS L Sbjct: 543 LIQFNTIVFAFCYCYYSISIRPISTLGWFFWSLL 576 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +2 Query: 86 LLQWLQTVFAFCIC 127 L+Q+ VF+FC C Sbjct: 262 LIQFNTIVFSFCYC 275 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,021 Number of Sequences: 336 Number of extensions: 3090 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -