BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0003 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 7e-16 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 81 7e-16 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 3e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 5e-15 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 75 3e-14 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 5e-14 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 74 8e-14 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 74 8e-14 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 74 8e-14 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 74 8e-14 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 74 8e-14 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 74 8e-14 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 74 8e-14 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 74 8e-14 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 74 8e-14 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 74 8e-14 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 74 8e-14 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 74 8e-14 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 74 8e-14 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 8e-14 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 74 8e-14 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 2e-13 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 2e-13 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 72 3e-13 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 3e-13 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 4e-13 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 71 6e-13 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 6e-13 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 71 8e-13 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 70 1e-12 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 70 1e-12 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 70 1e-12 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 70 1e-12 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 70 1e-12 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 70 1e-12 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 70 1e-12 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 70 1e-12 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 70 1e-12 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 70 1e-12 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 70 1e-12 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 70 1e-12 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 70 1e-12 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 70 1e-12 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 70 1e-12 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 70 1e-12 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 70 1e-12 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 70 1e-12 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 70 1e-12 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 70 1e-12 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 70 1e-12 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 70 1e-12 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 70 1e-12 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 70 1e-12 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 70 1e-12 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 70 1e-12 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 70 1e-12 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 70 1e-12 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 70 1e-12 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 70 1e-12 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 70 1e-12 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 70 1e-12 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 70 1e-12 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 70 1e-12 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 70 1e-12 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 70 1e-12 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 70 1e-12 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 70 1e-12 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 70 1e-12 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 70 1e-12 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 70 1e-12 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 70 1e-12 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 70 1e-12 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 70 1e-12 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 70 1e-12 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 70 1e-12 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 70 1e-12 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 70 1e-12 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 70 1e-12 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 70 1e-12 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 70 1e-12 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 70 1e-12 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 70 1e-12 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 70 1e-12 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 70 1e-12 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 70 1e-12 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 70 1e-12 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 70 1e-12 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 70 1e-12 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 70 1e-12 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 70 1e-12 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 70 1e-12 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 70 1e-12 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 70 1e-12 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 70 1e-12 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 70 1e-12 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 70 1e-12 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 70 1e-12 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 70 1e-12 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 70 1e-12 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 70 1e-12 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 70 1e-12 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 70 1e-12 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 70 1e-12 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 70 1e-12 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 70 1e-12 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 85.8 bits (203), Expect = 2e-17 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 386 IRPIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 +RP+VSRITIHW SFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAG 73 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 83.4 bits (197), Expect = 1e-16 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +2 Query: 392 PIVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 P +SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 115 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 80.6 bits (190), Expect = 7e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 401 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 37 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 80.6 bits (190), Expect = 7e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 401 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG 37 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 78.6 bits (185), Expect = 3e-15 Identities = 43/79 (54%), Positives = 52/79 (65%), Gaps = 5/79 (6%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASE----L*YDSL*GELGTGPPHKGR-KA 351 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS L DS L + P H + +A Sbjct: 87 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPLVSRPSHFSQARA 146 Query: 350 QLGANTEGRKHRSHDTLRC 294 +G+ GR + D ++C Sbjct: 147 NVGSRLPGRSSNAVDCVQC 165 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 77.8 bits (183), Expect = 5e-15 Identities = 35/39 (89%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = -3 Query: 496 KGDVLQGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 383 KGDVLQGD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 74.9 bits (176), Expect = 3e-14 Identities = 38/61 (62%), Positives = 40/61 (65%) Frame = +1 Query: 325 LPSVLAPSWAFLPLWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFAS 504 L V A SW + P G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFAS Sbjct: 804 LQYVKASSWFYKPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFAS 861 Query: 505 W 507 W Sbjct: 862 W 862 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 74.5 bits (175), Expect = 5e-14 Identities = 37/59 (62%), Positives = 41/59 (69%) Frame = +1 Query: 331 SVLAPSWAFLPLWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 S+LA S+ L + G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 61 SILATSYFILAILGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASW 117 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 235 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 903 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 15 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 390 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 239 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 306 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 372 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 64 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 46 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 282 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 266 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 255 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 280 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 464 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 133 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 299 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 149 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 208 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 600 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 236 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 514 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 97 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 405 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 9 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 73.7 bits (173), Expect = 8e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 198 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 72.9 bits (171), Expect = 1e-13 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 396 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 23 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 114 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 72.1 bits (169), Expect = 2e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 414 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 545 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 72.1 bits (169), Expect = 2e-13 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 411 L+ QL KGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 342 LLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 71.7 bits (168), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASWL 510 LAVVLQRRDWENPGVTQLNRLAAHPPFASWL Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWL 172 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 71.7 bits (168), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 416 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 92 >SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 71.7 bits (168), Expect = 3e-13 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = +1 Query: 358 LPLWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 +PL+G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 8 VPLYGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASW 55 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 71.7 bits (168), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 416 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 35 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 71.7 bits (168), Expect = 3e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 416 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 508 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAG 87 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 71.3 bits (167), Expect = 4e-13 Identities = 37/65 (56%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +1 Query: 319 CFLPSVLAPSWAFLPLWGGPVXXXXXXXXXXXXLA--VVLQRRDWENPGVTQLNRLAAHP 492 C + L P+W L PV LA VVLQRRDWENPGVTQLNRLAAHP Sbjct: 14 CVITHTLIPTWRALNDAPYPVGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 73 Query: 493 PFASW 507 PFASW Sbjct: 74 PFASW 78 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 70.9 bits (166), Expect = 6e-13 Identities = 35/56 (62%), Positives = 36/56 (64%) Frame = +1 Query: 340 APSWAFLPLWGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 AP WG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 57 APGKQCEKFWGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASW 110 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 70.9 bits (166), Expect = 6e-13 Identities = 39/92 (42%), Positives = 50/92 (54%), Gaps = 5/92 (5%) Frame = +1 Query: 247 MKAFENCHVP*RLCILHLNVSWLLCFLPSVLAPSWAFL-----PLWGGPVXXXXXXXXXX 411 MK F + + + +H++V C++ + +P + P W Sbjct: 1 MKHFTDTLISANIIAVHIDVVPFYCYVSNSCSPGDPLVLERPPPRWSS---NSPYSESYY 57 Query: 412 XXLAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 58 NSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 89 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.5 bits (165), Expect = 8e-13 Identities = 33/47 (70%), Positives = 34/47 (72%) Frame = +1 Query: 367 WGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 WG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 24 WGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 70.5 bits (165), Expect = 8e-13 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS-EL*YDSL*GELGTGPPHKGRK 354 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS +L + G L P + G+K Sbjct: 465 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVGGSLKWLPVNMGKK 519 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.5 bits (165), Expect = 8e-13 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 401 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 493 SRITIHWPSFYNVVTGKTLALPNLIALQHIP Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 491 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 64 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 73 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 96 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 67 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 99 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 161 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 75 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 64 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 54 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 79 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 88 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 82 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 98 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 69 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 245 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 140 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 57 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 76 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 410 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 136 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 112 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 37 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 47 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 67 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 132 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 74 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 369 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 109 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 79 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 88 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 163 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 92 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 172 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 89 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 102 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 96 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 85 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 238 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 98 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 285 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 143 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 79 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 382 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 130 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 143 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 49 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 40 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 48 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 425 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 74 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 83 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 148 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 84 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 94 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 97 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 443 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 140 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 96 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 85 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 75 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 78 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 190 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 94 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 81 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 117 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 66 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 92 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 84 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 71 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 214 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 69 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 83 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 80 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 63 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 64 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 78 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 68 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 161 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 70 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 113 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 51 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 182 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 369 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 50 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 138 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 115 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 665 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 89 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 294 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 323 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 87 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 45 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 65 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 411 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 440 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 95 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 124 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 80 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 122 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 211 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 240 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 242 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 62 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 77 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 67 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 72 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 147 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 176 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 74 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 64 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 84 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 69 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 104 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 195 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 224 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 82 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 61 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 86 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 115 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 38 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 51 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 78 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 216 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 96 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 79 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 86 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 515 LISQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 417 L+ QLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 16 LLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 129 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 58 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 70.1 bits (164), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 418 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 507 LAVVLQRRDWENPGVTQLNRLAAHPPFASW Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASW 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,102,513 Number of Sequences: 59808 Number of extensions: 394327 Number of successful extensions: 4978 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4974 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -