BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0896.Seq (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 3.3 X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. 22 5.8 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 22 5.8 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 22 5.8 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 22.6 bits (46), Expect = 3.3 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 341 IHFRKEKGFKVHWNAGRLENFLYSVDKLRPTPSP 240 + +KE G+KV W+ + +Y D+ SP Sbjct: 303 VELQKEGGWKVVWDDTQKNTHMYKGDQWVAFDSP 336 >X72339-1|CAA51066.1| 133|Tribolium castaneum abdominal protein. Length = 133 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 641 RSEIRAYCEIRFRLRREDGPQEGDRRPQ 724 + E+RA EI + RRE QE ++ Q Sbjct: 62 KKELRAVKEINEQARREREEQERHKQQQ 89 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 641 RSEIRAYCEIRFRLRREDGPQEGDRRPQ 724 + E+RA EI + RRE QE ++ Q Sbjct: 213 KKELRAVKEINEQARREREEQERHKQQQ 240 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 641 RSEIRAYCEIRFRLRREDGPQEGDRRPQ 724 + E+RA EI + RRE QE ++ Q Sbjct: 272 KKELRAVKEINEQARREREEQERHKQQQ 299 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,411 Number of Sequences: 336 Number of extensions: 4261 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -