BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0896.Seq (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 4.2 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 24 5.5 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 5.5 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 9.6 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 315 QSPLECWPP*KLLVQRRQAQAYTVP 241 +S + W P KL VQR + A T+P Sbjct: 1205 RSSIRNWYPDKLTVQRNPSAATTLP 1229 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 189 GSKWCITYIFLCCYRTCVYTLS 124 G C T+ F+C Y + TLS Sbjct: 225 GFSTCYTFTFICLYLFFIITLS 246 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 86 IFFELLCRDLNMLERVYTQVR 148 I F+ +CRD+ L R+Y R Sbjct: 218 IEFQKVCRDIEYLTRLYVSYR 238 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.0 bits (47), Expect = 9.6 Identities = 11/53 (20%), Positives = 19/53 (35%) Frame = +1 Query: 109 GSQHVGKGVHTSSVTTEKNVCYAPFGALQPRATKEGRIKCTLIPGDGVGLSLS 267 G +G+G+HT + PF + T ++ T G L+ Sbjct: 1025 GGTEMGQGLHTKMIQVAATALGIPFDRIHISETSTDKVPNTSATAASAGSDLN 1077 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,874 Number of Sequences: 2352 Number of extensions: 17961 Number of successful extensions: 25 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -