BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0887.Seq (802 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 23 3.7 AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A prot... 23 3.7 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 23 3.7 AF017414-2|AAB70261.1| 150|Tribolium castaneum abdominal-A prot... 23 3.7 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 23 3.7 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 726 LFAPSCTSATVCDVTLHHQELTTDLP 649 +FAP+ + V V +HH+ L +P Sbjct: 30 VFAPANITTEVKSVEMHHEALPEAVP 55 >AF017415-2|AAB70263.1| 284|Tribolium castaneum abdominal-A protein. Length = 284 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 207 LPAARAPGDALDHLRSVSPHHNGLRPRRA-SIQEASSSPGTAIKY 338 L A P D++ + HHNG A S+ AS+S A ++ Sbjct: 57 LAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASASMAVAAQF 101 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 207 LPAARAPGDALDHLRSVSPHHNGLRPRRA-SIQEASSSPGTAIKY 338 L A P D++ + HHNG A S+ AS+S A ++ Sbjct: 116 LAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASASMAVAAQF 160 >AF017414-2|AAB70261.1| 150|Tribolium castaneum abdominal-A protein. Length = 150 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 207 LPAARAPGDALDHLRSVSPHHNGLRPRRA-SIQEASSSPGTAIKY 338 L A P D++ + HHNG A S+ AS+S A ++ Sbjct: 57 LAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASASMAVAAQF 101 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 22.6 bits (46), Expect = 3.7 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +3 Query: 207 LPAARAPGDALDHLRSVSPHHNGLRPRRA-SIQEASSSPGTAIKY 338 L A P D++ + HHNG A S+ AS+S A ++ Sbjct: 116 LAANVTPADSMVNYTLGQHHHNGAAVSAASSVSAASASMAVAAQF 160 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,344 Number of Sequences: 336 Number of extensions: 4480 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -