BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0874.Seq (770 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0945 - 12614658-12614909,12615200-12615325,12616684-126168... 28 7.2 07_03_0408 - 17798033-17798181,17798349-17798616,17798707-177987... 28 9.5 >03_02_0945 - 12614658-12614909,12615200-12615325,12616684-12616872, 12617059-12617169,12617629-12617744,12617861-12617966 Length = 299 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 440 VITTEPCIRLT*NLVKFMGSVIYD-LWGAKALCTCCTFVLNEWTP 571 ++T P + + ++VK GSVI+D L A A+ FV EW P Sbjct: 118 ILTPLPRMNIPFDIVKGKGSVIFDPLRTAAAVNEVREFVPEEWVP 162 >07_03_0408 - 17798033-17798181,17798349-17798616,17798707-17798797, 17800458-17800585,17800760-17800891 Length = 255 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +3 Query: 567 LLLTAHDINIIDRDKRVNRQNVK*LRARAKTT---VPT 671 LLL H + DR + NR+ + LR RAKTT VPT Sbjct: 111 LLLARHQLVENDRIRNGNREALTALRKRAKTTKTSVPT 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,418,826 Number of Sequences: 37544 Number of extensions: 338468 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -