BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0873.Seq (478 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled ... 25 1.4 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 24 3.1 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 22 9.6 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 22 9.6 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 22 9.6 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 22 9.6 AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein p... 22 9.6 >AY500851-1|AAS77205.1| 605|Anopheles gambiae G-protein coupled receptor 3 protein. Length = 605 Score = 25.0 bits (52), Expect = 1.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 243 LLQIHGQVPATHLSNVCLINF 305 LLQ+ GQ+PAT +NV + F Sbjct: 475 LLQVFGQIPATQ-TNVAIATF 494 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 23.8 bits (49), Expect = 3.1 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = -3 Query: 464 RYFSSLPTVPGVGNLRACCLPWMW*PFLRLPLRNRTLIPRYP 339 RY L + + NLR + LR NRT PRYP Sbjct: 263 RYAQGLGRIEPLANLREPVREAYYPKLLRTS-NNRTFCPRYP 303 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 214 KSLILMNLDNFCRSMVKY 267 K +L +LD CRS V+Y Sbjct: 153 KITVLRDLDEGCRSRVQY 170 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 465 HLKDASPFLQERAVK 479 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 288 HLKDASPVLDHGSAK 244 HLKDASP L + K Sbjct: 449 HLKDASPFLQERAVK 463 >AB097148-1|BAC82627.1| 357|Anopheles gambiae gag-like protein protein. Length = 357 Score = 22.2 bits (45), Expect = 9.6 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 Query: 387 VSQAPSPESNPDSPLPVTTMVVAETTIES 301 V AP P + D P VT E+ +ES Sbjct: 298 VLPAPFPGPSTDEPRTVTRKRTTESDVES 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 519,176 Number of Sequences: 2352 Number of extensions: 11276 Number of successful extensions: 66 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -