BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0873.Seq (478 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ... 32 0.90 AY210419-1|AAO34702.1| 3501|Homo sapiens CUB and sushi multiple ... 29 6.3 AB114605-1|BAC82444.1| 3667|Homo sapiens CSMD3 protein isoform 2... 29 6.3 AB114604-1|BAC82443.1| 3707|Homo sapiens CSMD3 protein isoform 1... 29 6.3 AB067481-1|BAB67787.2| 2977|Homo sapiens KIAA1894 protein protein. 29 6.3 >AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor marker CA125 protein. Length = 22152 Score = 32.3 bits (70), Expect = 0.90 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = -2 Query: 477 KSPVSLFFVTT--YRAGSG*FARLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVA 319 ++P + ++TT S F+ + PS+ + + SPES P SPLPVT ++ + Sbjct: 5614 RTPGDVSWMTTPPVEETSSGFSLMSPSMTSPSPVSSTSPESIPSSPLPVTALLTS 5668 >AY210419-1|AAO34702.1| 3501|Homo sapiens CUB and sushi multiple domains 3 protein. Length = 3501 Score = 29.5 bits (63), Expect = 6.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 436 REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 329 R W P+ CG RF G SG + P +P DN+ Sbjct: 1260 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1297 >AB114605-1|BAC82444.1| 3667|Homo sapiens CSMD3 protein isoform 2 protein. Length = 3667 Score = 29.5 bits (63), Expect = 6.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 436 REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 329 R W P+ CG RF G SG + P +P DN+ Sbjct: 1361 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1398 >AB114604-1|BAC82443.1| 3707|Homo sapiens CSMD3 protein isoform 1 protein. Length = 3707 Score = 29.5 bits (63), Expect = 6.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 436 REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 329 R W P+ CG RF G SG + P +P DN+ Sbjct: 1401 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 1438 >AB067481-1|BAB67787.2| 2977|Homo sapiens KIAA1894 protein protein. Length = 2977 Score = 29.5 bits (63), Expect = 6.3 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = -1 Query: 436 REWVICAPAAFLGCGSRFSGSLSG--IEP*FPVTRDNH 329 R W P+ CG RF G SG + P +P DN+ Sbjct: 741 RAWDYPLPSCIAECGGRFKGESSGRILSPGYPFPYDNN 778 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,020,838 Number of Sequences: 237096 Number of extensions: 1458115 Number of successful extensions: 3883 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3883 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -