BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0873.Seq (478 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.55 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.55 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.2 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 6.8 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 9.0 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.55 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 406 RQQARKLPTPGTVGSDE 456 R+Q RK TPG V SDE Sbjct: 1768 RRQQRKQQTPGDVESDE 1784 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.55 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 406 RQQARKLPTPGTVGSDE 456 R+Q RK TPG V SDE Sbjct: 1764 RRQQRKQQTPGDVESDE 1780 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 2.2 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 20 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 154 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 6.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 467 YRYFSSLPTVP 435 YRY ++PTVP Sbjct: 221 YRYGDAIPTVP 231 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 20.6 bits (41), Expect = 9.0 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = -2 Query: 234 IHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACIS 127 I+Q L + +IG+ + + +PS++ V+++ +S Sbjct: 227 IYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVS 262 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,795 Number of Sequences: 438 Number of extensions: 2652 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -