BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0869.Seq (588 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 1.4 EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 2.5 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 3.3 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 3.3 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 7.7 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 1.4 Identities = 7/21 (33%), Positives = 15/21 (71%) Frame = +1 Query: 274 YPEEDTPEEIIQRRGVVLSEL 336 YP E+ EE+ ++ G+ +S++ Sbjct: 257 YPSEEAKEELARKCGITVSQV 277 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 412 MRDPKTLINHLSTNKEYEFKIEMIDSM 492 + DP T L+TN+ YE + DS+ Sbjct: 144 LSDPNTNKLKLNTNESYELTVLKSDSL 170 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 248 YVMTSEECSILKKTLLKKLYSGEV*FFRNCR 340 Y+ T+ C++LKK L +L+ + F C+ Sbjct: 88 YLETTWICTLLKKDKLLELFKRLIHFDTKCQ 118 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +2 Query: 248 YVMTSEECSILKKTLLKKLYSGEV*FFRNCR 340 Y+ T+ C++LKK L +L+ + F C+ Sbjct: 106 YLETTWICTLLKKDKLLELFKRLIHFDTKCQ 136 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.0 bits (42), Expect = 7.7 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -1 Query: 393 YIISLHESQYWLYCILKFLQFRKNYTSPLYNFFRS 289 Y + QY + L F +NY LYN F S Sbjct: 117 YAVYYWRQQYEDFWHRYTLSFIENYCQFLYNCFHS 151 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,972 Number of Sequences: 336 Number of extensions: 2631 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14726181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -