BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0864.Seq (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0406 - 33703767-33704045,33705167-33705226,33705295-337053... 29 3.7 08_01_0961 - 9622444-9622928,9623011-9623102,9623862-9624002,962... 28 6.4 >03_06_0406 - 33703767-33704045,33705167-33705226,33705295-33705378, 33705991-33706093,33706427-33706487,33706993-33707026 Length = 206 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 78 LYIFFMY*MYKLITYGIYNIKIKLYYVGCCKD 173 L++FF Y KL G Y+ K K + CC + Sbjct: 103 LHVFFSYITVKLQFLGFYDFKSKTHQDACCPE 134 >08_01_0961 - 9622444-9622928,9623011-9623102,9623862-9624002, 9624460-9624506,9624581-9624639,9624780-9624940, 9625021-9625196,9625284-9625355,9625820-9625879, 9625997-9626191 Length = 495 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 511 QVGRMLVCLYGIKKIYNQLVMF*LNTHQK 597 Q M CLYG K+ LV+F N H+K Sbjct: 85 QTALMQACLYGHWKVVQILVLFKANIHKK 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,365,795 Number of Sequences: 37544 Number of extensions: 297561 Number of successful extensions: 482 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -