BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0862.Seq (759 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000584C75 Cluster: PREDICTED: similar to GA16412-PA... 34 4.4 >UniRef50_UPI0000584C75 Cluster: PREDICTED: similar to GA16412-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to GA16412-PA - Strongylocentrotus purpuratus Length = 379 Score = 33.9 bits (74), Expect = 4.4 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = -3 Query: 280 FFLKLKPCILIILVQDFFL-LAPFYVLHLQSSNCKPFVCVTAHYQFRIRFVVPCHCK 113 FF+ + P +++L + L +A F VL + SSN P + H FR+ F HC+ Sbjct: 293 FFVCVVPYSVLLLFRVRHLAVAYFAVLFVLSSNINPILYAAKHPDFRLVFTAMLHCR 349 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,313,952 Number of Sequences: 1657284 Number of extensions: 12896179 Number of successful extensions: 29066 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 27362 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28914 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62969581935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -