BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0862.Seq (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 3.5 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 8.1 AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 21 8.1 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 576 VSVMSSSNGFLRIVATDGN 632 VS+++ NG +VAT G+ Sbjct: 34 VSILTIDNGVFEVVATSGD 52 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 8.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 692 LKSDLQGGSAPTRYPADKDTISVGGY 615 L DLQG SAP K ++G Y Sbjct: 178 LGKDLQGISAPVEAHLRKGRGAIGAY 203 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/33 (24%), Positives = 16/33 (48%) Frame = +3 Query: 15 PVFYYESIYRFILSRY*KLN*PTLLRKWQRIQL 113 P+F++ S +L P L +W +I++ Sbjct: 96 PLFFFHSFMTSVLFSQVASRWPLFLNEWTKIEI 128 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,544 Number of Sequences: 336 Number of extensions: 3923 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -