BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0859.Seq (700 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70037-4|CAA93877.1| 146|Caenorhabditis elegans Hypothetical pr... 28 7.4 Z54237-9|CAA90991.1| 1424|Caenorhabditis elegans Hypothetical pr... 28 7.4 Z54235-11|CAA90978.1| 1424|Caenorhabditis elegans Hypothetical p... 28 7.4 AF040661-10|AAG24215.1| 426|Caenorhabditis elegans Hypothetical... 27 9.8 >Z70037-4|CAA93877.1| 146|Caenorhabditis elegans Hypothetical protein T27D12.3 protein. Length = 146 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 292 RPSGRWCEATIRGLCLNASKAEAS 221 RPSG WC GL L ++ EAS Sbjct: 35 RPSGPWCVKLFVGLYLQGNRNEAS 58 >Z54237-9|CAA90991.1| 1424|Caenorhabditis elegans Hypothetical protein T11B7.4d protein. Length = 1424 Score = 27.9 bits (59), Expect = 7.4 Identities = 19/66 (28%), Positives = 26/66 (39%) Frame = +3 Query: 93 DPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPRMVAS 272 + GL R + + ET +K H P S +V + R A A F PR+ Sbjct: 789 ESRGLHRHEEKAQIETSTIKIH---EPSSPPPSVHKFGAVNTRAAPAPVQFMQTPRIAVK 845 Query: 273 HHRPLG 290 H P G Sbjct: 846 IHEPTG 851 >Z54235-11|CAA90978.1| 1424|Caenorhabditis elegans Hypothetical protein T11B7.4d protein. Length = 1424 Score = 27.9 bits (59), Expect = 7.4 Identities = 19/66 (28%), Positives = 26/66 (39%) Frame = +3 Query: 93 DPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFRHNPRMVAS 272 + GL R + + ET +K H P S +V + R A A F PR+ Sbjct: 789 ESRGLHRHEEKAQIETSTIKIH---EPSSPPPSVHKFGAVNTRAAPAPVQFMQTPRIAVK 845 Query: 273 HHRPLG 290 H P G Sbjct: 846 IHEPTG 851 >AF040661-10|AAG24215.1| 426|Caenorhabditis elegans Hypothetical protein W10G11.6 protein. Length = 426 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -1 Query: 331 REEPQFRTFGSCTRPSGRWCEATIRGLCLNASKAEASLA 215 R EP +R F RPSG WC G +A+KA+A A Sbjct: 255 RCEPGWRFFN---RPSGGWCIRVFTG--FHAAKADAEAA 288 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,119,532 Number of Sequences: 27780 Number of extensions: 330010 Number of successful extensions: 849 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 849 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -