BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0856X.Seq (529 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyc... 26 3.0 SPCC613.08 |||CDK regulator |Schizosaccharomyces pombe|chr 3|||M... 26 4.0 SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosa... 26 4.0 SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosac... 25 7.0 SPBC115.02c |||AFG1 family mitochondrial ATPase|Schizosaccharomy... 25 7.0 SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pom... 25 7.0 SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces p... 25 9.2 >SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyces pombe|chr 3|||Manual Length = 1088 Score = 26.2 bits (55), Expect = 3.0 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +2 Query: 260 PLRRTTGVYWI*KIKRNNTRNSSILRQHDTLQIINKLTRHKTND 391 PLR T+ Y++ +NN N+S L Q + L+ + + K +D Sbjct: 266 PLRETSNPYFLRDFLKNNA-NTSTLGQSEQLRYLEEALSLKLSD 308 >SPCC613.08 |||CDK regulator |Schizosaccharomyces pombe|chr 3|||Manual Length = 325 Score = 25.8 bits (54), Expect = 4.0 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 399 IC*SFVLCLVNLLIICSVSCCRNIELFLVLFRLIFYIQ 286 +C F L+ +L ICS+ C + FLV F L I+ Sbjct: 1 MCPLFKTYLLYILKICSIPCLAYVVNFLVCFVLFTNIK 38 >SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosaccharomyces pombe|chr 1|||Manual Length = 722 Score = 25.8 bits (54), Expect = 4.0 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 367 INETQNKRLTNI*KYNNERNARSVRGFVADCRRSSPASPAITRPRVG 507 +N Q R+T+ +N + + + FV DC + SP + P++G Sbjct: 367 VNSMQKMRVTSPVDHNEQPESSTAEMFV-DCTIEASQSPLLHIPKLG 412 >SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2670 Score = 25.0 bits (52), Expect = 7.0 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +2 Query: 308 NNTRNSSILRQHDTLQIINKLTRHKTND*QIYENTIMRETRDQYEALW 451 N+ R S L D I+ KL+ K ND I+ + I + D LW Sbjct: 525 NSERISHTLELQD---ILVKLSTPKNNDVFIFSSKITNKLNDDQSKLW 569 >SPBC115.02c |||AFG1 family mitochondrial ATPase|Schizosaccharomyces pombe|chr 2|||Manual Length = 454 Score = 25.0 bits (52), Expect = 7.0 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -1 Query: 331 YRTISRIVSFNFLYPVNSSRASERTQHFFL*Y 236 YR + +LYP NS + +++FL Y Sbjct: 266 YRRLKSKTEDTYLYPANSPEVKKALENWFLCY 297 >SPCC794.06 |||TDT malic acid transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 178 YCFHFYYF*ISNTLMFSWRTKVTTLFEFCTNFRLI 74 Y F FY ++F ++ + TL+ C FR I Sbjct: 51 YHFRFYGLNTLGKIIFIFQLSILTLYICCITFRFI 85 >SPAC607.10 |spo3||sporulation protein Spo3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1028 Score = 24.6 bits (51), Expect = 9.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 136 MFSWRTKVTTLFEFCTNFRLIYIYKNELL 50 M S++ ++EFC ++KNE+L Sbjct: 768 MLSFKYSANEIYEFCGTHSRAEVHKNEVL 796 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,895,531 Number of Sequences: 5004 Number of extensions: 35083 Number of successful extensions: 77 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -