BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0851.Seq (703 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 57 2e-08 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 57 2e-08 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 57 2e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 57 2e-08 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 57 2e-08 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 3e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 48 1e-05 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 47 1e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 46 2e-05 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 40 0.001 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.68 SB_33291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) 30 2.1 SB_39969| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_32318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_14772| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 28 6.4 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 28 6.4 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 28 6.4 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 28 6.4 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 6.4 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 28 6.4 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 28 6.4 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 28 6.4 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 28 6.4 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 28 6.4 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 28 6.4 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 28 6.4 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_37941| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 28 6.4 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 28 6.4 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 28 6.4 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_43871| Best HMM Match : CENP-B_N (HMM E-Value=6) 28 8.4 SB_31968| Best HMM Match : REX1 (HMM E-Value=3.1) 28 8.4 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 28 8.4 SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) 28 8.4 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 3 PSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 59 PSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 627 PSHDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 38 PSHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 40 PSHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 1878 PSHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 38 PSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 32 PSHDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 81 PSHDVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 59 PSHDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 70 PSHDVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 46 PSHDVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 56.8 bits (131), Expect = 2e-08 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRANW 638 PSHDVVKRRPVNCNTTHYRANW Sbjct: 70 PSHDVVKRRPVNCNTTHYRANW 91 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 697 HDVVKRRPVNCNTTHYRANW 638 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 3e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 697 HDVVKRRPVNCNTTHYRANW 638 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 700 SHDVVKRRPVNCNTTHYRAN 641 SHDVVKRRPVNCNTTHYRAN Sbjct: 21 SHDVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = +2 Query: 638 PIRPIVSRITIHWPSFYNVVTG 703 PIRPIVSRITIHWP+FYN TG Sbjct: 39 PIRPIVSRITIHWPAFYNAPTG 60 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 47.2 bits (107), Expect = 1e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 Query: 703 PSHDVVKRRPVNCNTTHYRAN 641 PSHD KRRPVNCNTTHYRAN Sbjct: 77 PSHDGEKRRPVNCNTTHYRAN 97 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 46.4 bits (105), Expect = 2e-05 Identities = 22/35 (62%), Positives = 24/35 (68%) Frame = +2 Query: 596 GRHSNTSLAWGARYPIRPIVSRITIHWPSFYNVVT 700 G S+ + A PIRPIVS ITIHWPSFYN VT Sbjct: 27 GSTSSRAAATVGGAPIRPIVSHITIHWPSFYNGVT 61 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 641 IRPIVSRITIHWPSFYNVVTG 703 +RP+VSRITIHW SFYNVVTG Sbjct: 33 LRPVVSRITIHWTSFYNVVTG 53 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +2 Query: 647 PIVSRITIHWPSFYNVVTG 703 P +SRITIHWPSFYNVVTG Sbjct: 77 PYMSRITIHWPSFYNVVTG 95 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.1 bits (92), Expect = 8e-04 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 2/30 (6%) Frame = +2 Query: 605 SNTSLAWG--ARYPIRPIVSRITIHWPSFY 688 S +S+A G IRPIVSRITIHWPSFY Sbjct: 4 STSSIAAGIAVELAIRPIVSRITIHWPSFY 33 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVVTG 703 SRITIHWPSFYNVVTG Sbjct: 2 SRITIHWPSFYNVVTG 17 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVV 697 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.7 bits (76), Expect = 0.073 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +2 Query: 656 SRITIHWPSFYNVV 697 SRITIHWPSFYNV+ Sbjct: 2 SRITIHWPSFYNVM 15 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 671 HWPSFYNVVTG 703 HWPSFYNVVTG Sbjct: 5 HWPSFYNVVTG 15 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 671 HWPSFYNVVTG 703 HWPSFYNVVTG Sbjct: 62 HWPSFYNVVTG 72 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 671 HWPSFYNVVTG 703 HWPSFYNVVTG Sbjct: 5 HWPSFYNVVTG 15 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 31.5 bits (68), Expect = 0.68 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 671 HWPSFYNVVTG 703 HWPSFYNVVTG Sbjct: 57 HWPSFYNVVTG 67 >SB_33291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1227 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 Query: 196 PAGSHHHHEFPPPARAASTGPSIVQDHQSLAGRSRRHDDPRH 71 P +HH HE P RA G + + H S+A +RR D H Sbjct: 448 PRTTHHEHENTIPRRAKGVGIARDEKH-SIANNTRRRDRVFH 488 >SB_28137| Best HMM Match : rve (HMM E-Value=0.00026) Length = 293 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = -1 Query: 244 RNRLHAPVCPIIPG*RPAGSHHHHEFPPPARAASTGPSIVQDHQSLAGRSRRHDDPRHFG 65 RNR H P P P H PPP R + H + SRR P H G Sbjct: 234 RNRQHIRSVPPTPSPTPPSPTHPSPLPPPQRTQHIRG--MMHHLITSTHSRRPATPAHLG 291 >SB_39969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +3 Query: 399 LLHAGEENLFSGLTALSAEFTIGEGELMAHDVPLGCARM 515 L+HA E+ L L AL E +G+G ++ ++ LG R+ Sbjct: 23 LVHALEKLLQERLQALGQELVLGQGRVLGQELVLGQGRV 61 >SB_32318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -2 Query: 597 PSSLPVSTSCVFPLGRCEQVPDMRSSY-SSGRIPEGHHEPSTHLR 466 P P SC P RC P + Y SG I ++P T LR Sbjct: 32 PLLAPGGPSCTHPAERCPSSPQALNKYRKSGIIRNRTYQPETQLR 76 >SB_14772| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 614 TCCCGDRHHFRSARRAFSPWE 552 TC CGD +AR AF WE Sbjct: 83 TCLCGDLSEMITAREAFQMWE 103 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 28.7 bits (61), Expect = 4.8 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +2 Query: 671 HWPSFYNVVTG 703 HWPSFYN VTG Sbjct: 5 HWPSFYNDVTG 15 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 46 QSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 258 QSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 926 QSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 39 QSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 38 QSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 413 QSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 262 QSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 329 QSRRCKTTASEL 340 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 38 QSRRCKTTASEL 49 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 395 QSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 87 QSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 46 QSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 39 QSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 39 QSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 46 QSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 46 QSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 69 QSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 305 QSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 289 QSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 39 QSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 278 QSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 303 QSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 487 QSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 156 QSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 322 QSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 172 QSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 46 QSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 365 QSRRCKTTASEL 376 >SB_37941| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1328 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = -3 Query: 392 PWQNMTAVIEPFYPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEMPCTKSPPCACLPD 213 PW+ E F NG R Y + ++ + H N + +E+ C K P + LP+ Sbjct: 284 PWKCPDKQREHFIDGITNGARWYSISGGMQDYNYVH-SNAFEITLELGCEKFPNASALPE 342 Query: 212 Y 210 Y Sbjct: 343 Y 343 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 39 QSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 46 QSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 32 QSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 231 QSRRCKTTASEL 242 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +3 Query: 129 IDGPVDAARAGGGNS*WWCDPAGRYPGIIGQTGAWRRFRTG 251 +D DA++AGG D G++PG++GQ W + + G Sbjct: 1224 VDYQYDASQAGGLE-----DYYGQHPGVVGQESHWDQHQGG 1259 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 623 QSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 259 QSRRCKTTASEL 270 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 68 QSRRCKTTASEL 79 >SB_18606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1401 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = -1 Query: 205 G*RPAGSHHHHEFPPPARAASTGPSIVQDHQSLAGRSRRHDDPRHFGGCHHH 50 G P HHHH F R + + P I L + P H HHH Sbjct: 844 GTTPGEIHHHHHFKNTGRRSKSSPEIPVSPTVLGTTASAPVSPVH----HHH 891 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 99 QSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 537 QSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 39 QSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 120 QSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 428 QSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 32 QSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = -3 Query: 701 QSRRCKTTASEL 666 QSRRCKTTASEL Sbjct: 221 QSRRCKTTASEL 232 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 703 PSHDVVKRRPV 671 PSHDVVKRRPV Sbjct: 57 PSHDVVKRRPV 67 >SB_43871| Best HMM Match : CENP-B_N (HMM E-Value=6) Length = 214 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = -3 Query: 608 CCGDRHHFRSARRAFSPWEGANKFLI*DHHIHPGASQRDI 489 C D H FRS+ R W K L HH P A ++ Sbjct: 44 CYKDAHGFRSSHRGGPLWNNLKKML---HHQPPSAQTEEL 80 >SB_31968| Best HMM Match : REX1 (HMM E-Value=3.1) Length = 216 Score = 27.9 bits (59), Expect = 8.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 236 PPCACLPDYP 207 PPCACLPD P Sbjct: 161 PPCACLPDLP 170 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 500 GMRPDEYDDLISGTCSHLPKGKTHDVLTG 586 G++PD+ +++S T HL GK D L G Sbjct: 1345 GVQPDKIPNVVSTTIEHLNLGKWADKLCG 1373 >SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) Length = 444 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 703 PSHDVVKRRPV 671 PSHDVVKRRPV Sbjct: 219 PSHDVVKRRPV 229 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 703 PSHDVVKRRPV 671 PSHDVVKRRPV Sbjct: 15 PSHDVVKRRPV 25 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 703 PSHDVVKRRPV 671 PSHDVVKRRPV Sbjct: 15 PSHDVVKRRPV 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,819,016 Number of Sequences: 59808 Number of extensions: 643803 Number of successful extensions: 4707 Number of sequences better than 10.0: 97 Number of HSP's better than 10.0 without gapping: 4471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4701 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -