BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0850.Seq (763 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activati... 29 2.7 U39999-6|AAA81107.2| 198|Caenorhabditis elegans Hypothetical pr... 29 3.6 U23519-9|ABS19470.1| 203|Caenorhabditis elegans Hypothetical pr... 29 3.6 AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium bind... 28 8.3 AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 8.3 >U02289-1|AAA18934.1| 1439|Caenorhabditis elegans GTPase-activating protein protein. Length = 1439 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/43 (37%), Positives = 24/43 (55%) Frame = -1 Query: 526 YLKCTHPITRPRKSPVSLFFVTTSRAGSG*FARLLPSLDVVAV 398 +LK + P+ R SP + F +R GSG + ++ L VVAV Sbjct: 24 WLKSSRPLARGALSPAAYFRDLENRHGSGASSPIVGGLSVVAV 66 >U39999-6|AAA81107.2| 198|Caenorhabditis elegans Hypothetical protein F41G3.10 protein. Length = 198 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 692 CPQTCQYHRGCGAPTARRTNATTSFL 615 CP+TC Y G G T RT+ T + L Sbjct: 133 CPRTCGYCSGSGVVTTTRTSTTCADL 158 >U23519-9|ABS19470.1| 203|Caenorhabditis elegans Hypothetical protein F26G1.11 protein. Length = 203 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -2 Query: 738 LILNRRFLERRLTDDMSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRY 589 +I+ + R +++ +N++V + SA HK NYEL +F +RY Sbjct: 83 IIIEHGCTKGRSEEEIQSNINVYSEFPISLSALHKHNYEL--NQDFELRY 130 >AF099925-14|AAX55690.1| 679|Caenorhabditis elegans Calcium binding protein homologprotein 1, isoform d protein. Length = 679 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 424 LPSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTI 320 +P+ V+ ++ PS +S + VTT V+ TTI Sbjct: 559 VPTTTVIQTTETPSTKSKTTKKVKVTTTTVSTTTI 593 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 60 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 164 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,132,157 Number of Sequences: 27780 Number of extensions: 351207 Number of successful extensions: 924 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 918 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -