BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0845.Seq (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12968| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_3787| Best HMM Match : Pentapeptide_2 (HMM E-Value=3) 29 2.5 SB_26174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_12968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 32.3 bits (70), Expect = 0.36 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 Query: 532 PSIIITALLGTTLGFACFSAAAMLAERGS 618 P I++TA T + FACF+ +A+ AE+ S Sbjct: 70 PLIVVTAFFATVMIFACFTVSALWAEQRS 98 >SB_3787| Best HMM Match : Pentapeptide_2 (HMM E-Value=3) Length = 324 Score = 29.5 bits (63), Expect = 2.5 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 606 SKHSSSREACKSQGSAEQSSYYDRWVNYTDIFNRG 502 S + S R + S GSA+ SS D +V+Y +I+ G Sbjct: 266 SSNGSKRSSNSSTGSAKHSSDSDDYVDYQEIYGDG 300 >SB_26174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 885 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = +1 Query: 460 LSTWIWINIRHEHGSPVEYVSVVDPSIIITALLGTTLGFACFSAAAMLAERGSW 621 L + I +R + +PV + + +T + T L F CF AA LA +W Sbjct: 733 LGCYTAILVRVRYSTPVNPRRGGNLKLTLTLFIATLLSFLCFLPAATLALHVTW 786 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,502,277 Number of Sequences: 59808 Number of extensions: 419222 Number of successful extensions: 937 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -